KEGG   Streptomyces malaysiensis: SMALA_0595
Entry
SMALA_0595        CDS       T05189                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00071  Fatty acid degradation
smal00280  Valine, leucine and isoleucine degradation
smal00281  Geraniol degradation
smal00310  Lysine degradation
smal00360  Phenylalanine metabolism
smal00362  Benzoate degradation
smal00380  Tryptophan metabolism
smal00410  beta-Alanine metabolism
smal00627  Aminobenzoate degradation
smal00640  Propanoate metabolism
smal00650  Butanoate metabolism
smal00903  Limonene and pinene degradation
smal00930  Caprolactam degradation
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
smal01212  Fatty acid metabolism
Module
smal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SMALA_0595
   00650 Butanoate metabolism
    SMALA_0595
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMALA_0595
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMALA_0595
   00310 Lysine degradation
    SMALA_0595
   00360 Phenylalanine metabolism
    SMALA_0595
   00380 Tryptophan metabolism
    SMALA_0595
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMALA_0595
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SMALA_0595
   00281 Geraniol degradation
    SMALA_0595
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMALA_0595
   00627 Aminobenzoate degradation
    SMALA_0595
   00930 Caprolactam degradation
    SMALA_0595
Enzymes [BR:smal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SMALA_0595
SSDB
Motif
Pfam: ECH_2 ECH_1
Other DBs
NCBI-ProteinID: ATL80830
UniProt: A0A291SIZ2
Position
complement(893725..894837)
AA seq 370 aa
MTDSVTDRVTNSVPDSAAEDDAVLTRTEGRAGRLTLNRPRALNALTHPMATRIAEALTAW
ERDPAVRTVVIDGAGERGLCAGGDIRMIHRDVTSGGGAASRAFWRDEYTLNARIARYPKP
YVALMDGIVMGGGVGISAHGSVRIVTERSRVAMPETTIGFVPDVGGTHLLSRAPGELGTH
LALTGAAVGAADALRCGLADHVVPSGLLPALTRDLAAEPVADVLPRYAVEAPAGTLDGQR
EWIDHCYAADTVEEIVDRLMATGEPAAKETAQTLLTKSPTALKATLAAVRRARALGSLER
VMEQEYRVSCAALSRPDFVEGIRAQVIDKDRCPRWAPATLAEVTDAEVARFFAPPADGDL
RLTEALTEAE
NT seq 1113 nt   +upstreamnt  +downstreamnt
gtgaccgactccgtgaccgaccgcgtgaccaactccgtgcccgactccgccgccgaggac
gacgccgtgctgacgcgcaccgagggccgcgccgggcgtctcaccctcaaccgcccccgc
gccctcaacgccctcacccaccccatggcgacccggatcgccgaggccctcaccgcctgg
gagcgggacccggccgtccggaccgtggtgatcgacggggcgggggagcgcgggctgtgc
gcgggcggcgacatccgcatgatccatcgggatgtgacctcgggcggcggcgcggcatcg
agggcgttctggcgcgacgagtacacgctcaacgcccggatcgcccgctaccccaagccg
tatgtggccctgatggacggcatcgtcatgggcgggggcgtcgggatctcggcccacggc
agcgtgcggatcgtcaccgagcgctcccgggtggccatgcccgagaccacgatcggcttc
gtaccggacgtcggcggcacccatctgctgtcccgcgcaccgggcgaactgggcacccat
ctggcgctcacgggagcggcggtgggcgccgccgacgcgctgcgctgcgggctggccgac
catgtcgtcccctccgggctgctgcccgcgctgacccgggacctggccgcggagccggtg
gcggacgtccttccccggtacgccgtggaggccccggccggaaccctggacggtcagcgg
gagtggatcgaccactgctatgcggcggacaccgtcgaggagatcgtggaccggctgatg
gccaccggggaaccggccgccaaggagaccgcccagactctgctcaccaagtcccccacg
gcgctgaaggccacactggccgccgtccgccgggcccgggcgctcggctcgctggagcgg
gtcatggagcaggagtaccgcgtctcctgcgcggccctgtcccgcccggacttcgtcgag
ggcatccgcgcccaggtgatcgacaaggaccgctgcccccgctgggccccggccactctc
gccgaggtcacggacgcggaggtggcccgcttcttcgcaccgcccgccgacggggacctc
cgcctcaccgaggccctcaccgaggccgagtag

KEGG   Streptomyces malaysiensis: SMALA_0722
Entry
SMALA_0722        CDS       T05189                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00071  Fatty acid degradation
smal00280  Valine, leucine and isoleucine degradation
smal00281  Geraniol degradation
smal00310  Lysine degradation
smal00360  Phenylalanine metabolism
smal00362  Benzoate degradation
smal00380  Tryptophan metabolism
smal00410  beta-Alanine metabolism
smal00627  Aminobenzoate degradation
smal00640  Propanoate metabolism
smal00650  Butanoate metabolism
smal00903  Limonene and pinene degradation
smal00930  Caprolactam degradation
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
smal01212  Fatty acid metabolism
Module
smal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SMALA_0722
   00650 Butanoate metabolism
    SMALA_0722
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMALA_0722
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMALA_0722
   00310 Lysine degradation
    SMALA_0722
   00360 Phenylalanine metabolism
    SMALA_0722
   00380 Tryptophan metabolism
    SMALA_0722
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMALA_0722
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SMALA_0722
   00281 Geraniol degradation
    SMALA_0722
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMALA_0722
   00627 Aminobenzoate degradation
    SMALA_0722
   00930 Caprolactam degradation
    SMALA_0722
Enzymes [BR:smal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SMALA_0722
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ATL80957
UniProt: A0A291SJC6
Position
complement(1050206..1051012)
AA seq 268 aa
MTSGTEHLIVERVGATLVLTLNRPEARNALSLPMLVGLYDGWTEADEDDTVRSVVLTGAG
GAFCAGMDLKALAGGGRMAGEHVRDRLAADPDLHWKAMLRHHRPRKPVIAAVEGPCVAGG
TEILQGTDIRVAGRSATFGLFEVRRGLFPIGGSTVRLTRQLPRTHALEMLLTGRPYPAEE
AARIGLIGHVVPDGTALEKALEIAELINANGPLAVEAVKASVYETAEMTETDGLKSELER
GWPIFDTADAKEGSKAFAEKRPPVYRRA
NT seq 807 nt   +upstreamnt  +downstreamnt
gtgacaagcgggaccgaacacctcatcgtcgagcgcgtcggcgcgaccctggtgctcacc
ttgaaccggcccgaggccaggaacgcgctctcgctgccgatgctggtcgggctgtacgac
ggctggaccgaggccgacgaggacgacaccgtgcgctccgtggtgctcaccggcgccggt
ggggccttctgcgccggaatggacctcaaggcgctcgcgggcggcggccggatggccggc
gagcatgtccgcgaccgcctcgcggccgaccccgatctgcactggaaggcgatgctccgc
caccaccggccgcgcaagccggtcatcgccgccgtcgagggcccctgcgtcgcgggcggc
accgagatcctccagggcaccgatatccgggtcgcgggccgcagcgccaccttcgggctc
ttcgaggtccggcgcgggctgttccccatcggcggctccaccgtacggctgacccgccag
ctgccccgcacccacgccctggagatgctgctgaccgggcgcccctacccggccgaggag
gcggcgcggatcgggctcatcggccatgtcgtcccggacggcacggcgctggagaaggca
ctggagatcgcggagctgatcaacgccaacggcccgctcgccgtcgaggcggtcaaggcg
tccgtctacgagaccgccgagatgaccgagaccgacggcctgaagtccgaactcgaacgc
ggctggcccatcttcgacaccgccgacgccaaggagggctcgaaagccttcgcggagaaa
cggccgccggtctaccgccgggcgtga

KEGG   Streptomyces malaysiensis: SMALA_0831
Entry
SMALA_0831        CDS       T05189                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00071  Fatty acid degradation
smal00280  Valine, leucine and isoleucine degradation
smal00281  Geraniol degradation
smal00310  Lysine degradation
smal00360  Phenylalanine metabolism
smal00362  Benzoate degradation
smal00380  Tryptophan metabolism
smal00410  beta-Alanine metabolism
smal00627  Aminobenzoate degradation
smal00640  Propanoate metabolism
smal00650  Butanoate metabolism
smal00903  Limonene and pinene degradation
smal00930  Caprolactam degradation
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
smal01212  Fatty acid metabolism
Module
smal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SMALA_0831
   00650 Butanoate metabolism
    SMALA_0831
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMALA_0831
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMALA_0831
   00310 Lysine degradation
    SMALA_0831
   00360 Phenylalanine metabolism
    SMALA_0831
   00380 Tryptophan metabolism
    SMALA_0831
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMALA_0831
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SMALA_0831
   00281 Geraniol degradation
    SMALA_0831
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMALA_0831
   00627 Aminobenzoate degradation
    SMALA_0831
   00930 Caprolactam degradation
    SMALA_0831
Enzymes [BR:smal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SMALA_0831
SSDB
Motif
Pfam: ECH_1 ECH_2 Pox_A3L
Other DBs
NCBI-ProteinID: ATL81066
UniProt: A0A291SJH9
Position
1165410..1166180
AA seq 256 aa
MTVTTSGQPADTDEAAADVLLVEDRGPVRVLTLNRPDKLNALNTALTRALSTALTAAEDD
GEVRAVVLTGAGRGFCAGADLSEFSTLTPDEPDAVLERAALTARLQTQMQRMGTPVVSAV
RGAAVGGGAGLAIGADMAIAGTDLKFGYPELRHSIVPALVMTGLQRHLGRKLAFELISTG
RLLSASEAAAHGLVNRVVEPDQVVEAALGTAERWAAVEPRAIHAAKDLFYRVADLPTEAA
MRAGQDVNALMRGFRR
NT seq 771 nt   +upstreamnt  +downstreamnt
gtgaccgtcacgaccagcgggcagccggccgacacggacgaagcggccgccgatgtgctg
ctcgtcgaggaccgcggcccggtccgcgtcctcaccctcaaccgccccgacaagctcaac
gcgctgaacaccgcgctcacccgggccctgagcaccgcgctcaccgcggccgaggacgac
ggcgaggtccgtgccgtcgtcctcaccggcgccggccgcggtttttgcgcgggcgccgac
ctgtcggagttctccaccctcactccggacgaaccggacgccgtcctggagcgggcggcg
ctcaccgcgcgccttcagacgcagatgcaacggatgggcacaccggtcgtctccgccgtg
cgcggcgccgcggtgggcggtggcgccgggctcgccatcggcgccgatatggccatagcc
ggcacggacctgaagttcggctaccccgaattgcggcactcgatcgtgcccgccctggtc
atgaccgggctccagcgtcacctgggccgcaagctcgccttcgaactgatcagcacgggc
cggctgctctcggcctccgaggccgcggcgcacggtctggtgaaccgcgtcgtcgaaccg
gaccaggtggtcgaggccgcgctcggcacagccgagcggtgggccgccgtggagccccgc
gccatccacgcggccaaggacctcttctaccgcgtcgccgatctgccgaccgaggccgcg
atgcgggccggacaggacgtcaacgcactgatgcgggggttccgccggtga

KEGG   Streptomyces malaysiensis: SMALA_1309
Entry
SMALA_1309        CDS       T05189                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00071  Fatty acid degradation
smal00280  Valine, leucine and isoleucine degradation
smal00281  Geraniol degradation
smal00310  Lysine degradation
smal00360  Phenylalanine metabolism
smal00362  Benzoate degradation
smal00380  Tryptophan metabolism
smal00410  beta-Alanine metabolism
smal00627  Aminobenzoate degradation
smal00640  Propanoate metabolism
smal00650  Butanoate metabolism
smal00903  Limonene and pinene degradation
smal00930  Caprolactam degradation
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
smal01212  Fatty acid metabolism
Module
smal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SMALA_1309
   00650 Butanoate metabolism
    SMALA_1309
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMALA_1309
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMALA_1309
   00310 Lysine degradation
    SMALA_1309
   00360 Phenylalanine metabolism
    SMALA_1309
   00380 Tryptophan metabolism
    SMALA_1309
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMALA_1309
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SMALA_1309
   00281 Geraniol degradation
    SMALA_1309
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMALA_1309
   00627 Aminobenzoate degradation
    SMALA_1309
   00930 Caprolactam degradation
    SMALA_1309
Enzymes [BR:smal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SMALA_1309
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ATL81544
UniProt: A0A291SKY8
Position
1780021..1780839
AA seq 272 aa
MSDLYKHGTGDVLVERRDDGVLLITINRPERYNALTLPMFEEMNQIWADVERDEQTRVVV
ITGAGKAFCTGMDVAQPDPTPEDALAMLETERKRVATMLRIEKPIISAINGPAVGYGLST
ALLADISIAADDAVLIEGHTKVGVTAGDHAALIWPLLVGMAKTKYYVLTSEKLTGAEAER
IGLVSLSVPREQVLPRALEVASQLARGSQQALRFTKRALNAWLTNAMPQHELSSALEILD
FAGADYAEARQAFREKRPVDFPSARTVGGPAN
NT seq 819 nt   +upstreamnt  +downstreamnt
atgagtgacctctacaagcacggcactggcgacgtcctagtcgaacgccgcgacgacggt
gtcctcctcatcacgatcaatcgacccgagcggtacaacgcgctcaccctgccgatgttc
gaggagatgaaccagatctgggccgacgtcgagcgcgacgaacagacccgggtcgtcgtc
atcaccggggccggcaaagccttctgtaccgggatggacgtcgctcagcccgaccccacg
cccgaggacgcgctcgcgatgctggagaccgaacgcaagcgggtcgcgacgatgttgcgc
atcgagaagcccatcatctccgcgatcaacggccccgcggtcggctacgggctgtcgacc
gcgcttctcgccgacatcagcatcgccgcggacgacgcggtgctgatagaaggccacacc
aaggtcggtgtgaccgccggcgaccacgccgcgctcatctggccgttgcttgtcggcatg
gccaagaccaagtactacgtgctcacctccgagaagctgacgggcgccgaggccgagcgg
atcgggctcgtgagcctgtccgtcccccgcgagcaggtgctgccccgcgccctcgaggtc
gcgtcccagctggcccgcggttcccagcaggcgctccgtttcaccaagcgcgcgctcaac
gcctggctcaccaacgcgatgcctcagcacgagctgtcctcggcactcgagatcctcgac
ttcgccggtgccgactacgccgaagcacgccaggcattccgggagaagcgccccgtggac
ttcccctccgctcgcaccgttggcggaccggcgaactga

KEGG   Streptomyces malaysiensis: SMALA_3404
Entry
SMALA_3404        CDS       T05189                                 

Definition
(GenBank) hypothetical protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00071  Fatty acid degradation
smal00280  Valine, leucine and isoleucine degradation
smal00281  Geraniol degradation
smal00310  Lysine degradation
smal00360  Phenylalanine metabolism
smal00362  Benzoate degradation
smal00380  Tryptophan metabolism
smal00410  beta-Alanine metabolism
smal00627  Aminobenzoate degradation
smal00640  Propanoate metabolism
smal00650  Butanoate metabolism
smal00903  Limonene and pinene degradation
smal00930  Caprolactam degradation
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
smal01212  Fatty acid metabolism
Module
smal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SMALA_3404
   00650 Butanoate metabolism
    SMALA_3404
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMALA_3404
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMALA_3404
   00310 Lysine degradation
    SMALA_3404
   00360 Phenylalanine metabolism
    SMALA_3404
   00380 Tryptophan metabolism
    SMALA_3404
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMALA_3404
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SMALA_3404
   00281 Geraniol degradation
    SMALA_3404
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMALA_3404
   00627 Aminobenzoate degradation
    SMALA_3404
   00930 Caprolactam degradation
    SMALA_3404
Enzymes [BR:smal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SMALA_3404
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ATL83638
UniProt: A0A291SRW8
Position
complement(4385908..4386927)
AA seq 339 aa
MTDGSTTDRPLADGRKTDVPATGDSATGGPSTGGSLSGGSAGRLPIGEPTTGGSSTFRAP
LPFVRATFARGIATLTLDSPHNRNALSARLVAELREALAAAGRDDRVRAVLLTHTGTTFC
AGADLSEPPSASGTSGLVALLRSIVELPKPVVARVTGHVRAGGLGLLGACDISAAGRGAS
FAFTEARLGLAPAVISIPLLPRLDRRAAARYYLTGERFDAAEAARIGLVTIADPEGDADE
ALAPVLDGLRRGSPQGLAESKRLVTADVLGAFDRDGEPLAALSARLFASEEAREGMTAFL
ERREPVWIREAADAGAGPTAGVAPGTTAAGDTGAAGASR
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgacagacggttccacgaccgaccgcccgctggccgatggccgtaagaccgatgtcccg
gcgaccggagattccgcgaccggggggcccagcaccggtgggtcgctgagcggaggctcc
gccggaaggctgccgatcggagaacccacgaccggggggtccagcacgttccgcgcacct
ctgccgttcgtacgggccaccttcgcgcgcggtatcgccaccctcaccctggactcgccg
cacaaccgcaacgccctctcggcgcgcctggtcgccgagttgcgcgaggcgctggcggcg
gccgggcgggacgaccgcgtccgcgcggtgctgctcacgcacaccggcaccaccttctgc
gcgggcgcggacctgagcgaaccgccctcggcttcggggacgtccggcctggtggcgctg
ttgcggtcgatcgtggagctgcccaagccggtggtcgcccgggtcaccgggcatgtgcgg
gccggtgggctcgggctgctcggagcctgtgacatctcggcggccgggcgcggcgccagc
ttcgccttcaccgaggcgcggctcggcctcgccccggccgtcatctcgataccgctgctg
ccccggctggaccggcgcgcggcggcccgttactacctgacgggtgagcggttcgacgcc
gccgaggcggcccggatcgggctggtgacgatcgcggacccggaaggcgacgcggacgag
gcgctggcgcccgtcctcgacgggctgcgccggggctccccgcagggcctggccgagtcc
aagcggctggtgaccgccgatgtgctgggcgccttcgaccgggacggcgaaccgctggcc
gcgctgtcggcccgcctcttcgcctccgaggaggcccgcgagggcatgacggcgttcctg
gagcggcgggagccggtgtggatacgggaggcggcggacgccggggcgggaccgaccgcg
ggggtggcaccggggacgacggccgccggggacacgggcgccgcgggggcgtcccgatga

KEGG   Streptomyces malaysiensis: SMALA_6310
Entry
SMALA_6310        CDS       T05189                                 

Definition
(GenBank) fatty oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00071  Fatty acid degradation
smal00280  Valine, leucine and isoleucine degradation
smal00281  Geraniol degradation
smal00310  Lysine degradation
smal00362  Benzoate degradation
smal00380  Tryptophan metabolism
smal00410  beta-Alanine metabolism
smal00640  Propanoate metabolism
smal00650  Butanoate metabolism
smal00903  Limonene and pinene degradation
smal00930  Caprolactam degradation
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
smal01200  Carbon metabolism
smal01212  Fatty acid metabolism
Module
smal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SMALA_6310
   00650 Butanoate metabolism
    SMALA_6310
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMALA_6310
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMALA_6310
   00310 Lysine degradation
    SMALA_6310
   00380 Tryptophan metabolism
    SMALA_6310
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMALA_6310
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SMALA_6310
   00281 Geraniol degradation
    SMALA_6310
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMALA_6310
   00930 Caprolactam degradation
    SMALA_6310
Enzymes [BR:smal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SMALA_6310
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SMALA_6310
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SMALA_6310
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 F420_oxidored NAD_Gly3P_dh_N NAD_binding_8 UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: ATL86538
UniProt: A0A291T058
Position
7759748..7761991
AA seq 747 aa
MTHPTTASTIRWEQDDEGVVTLVLDDPGQSANTMNAAFIDSLDAIADRAEAERESISGII
VTSAKKTFFAGGDLNDLIEVGPDQAQEVYDKNLRIKRALRRIETLGRPVVAAINGAALGG
GLEIALTCHHRIALDAPGSRIGFPEVTLGLLPGSGGVARTVRLLGVTDALLKWLLQGTRY
TPRRAQEAGLVHEVAATREEMLTLARAFIAAHPESAQPWDDKDYRLPGGTPAQPKFAVNL
PAFPANLRKQLNGAPYPAQRNILAAAVEGSQVDFETAQTIEARYFTELVVGQTAKNMIQA
FFFDLQAVNSGANRPQGIEPQQVRKVAVLGAGMMGAGIAYACAKAGIEVVLKDVSVEAAA
KGKAYSEGLLAKALAKGRTTEAKRDGLLARITPTADLRDLEGCDAVIEAVFEDPALKHKV
FQEIEGVVAPDALLCSNTSTLPITLLSEGVQRAEDFIGLHFFSPVDKMPLVEIIKGERTG
DKALARAFDLVRQISKTPIVVNDSRAFFTSRVIGHFLNEGVAMVGEGIAPASVEQAAAQA
GYPAKVLSLMDELTLTLARKIREETRRATEEAGGDWRPHPADAVIDRMVEEFGRPGRSGG
AGFYDYDETTGRRTRLWPGLREHFAPGESGESGESGGSGGSGGSRGEGTRIPMEDMKERM
LFCEAIDTVRLLEEGVLTSVADANIGSILGIGFPGWTGGVLQYINGYEGGVAGFVARARQ
LEAAYGERFAPPALLLEKAERGERFMD
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgacccaccccacgacggcctcgaccatccgctgggagcaggacgacgaaggcgtcgtc
accctggtgctcgacgaccccggccagtccgccaacaccatgaacgccgcgttcatcgac
tccctcgacgcgatcgccgaccgcgccgaggccgagcgcgagtcgatcagcggcatcatc
gtcacctccgccaagaagaccttcttcgccggtggcgacctcaacgacctcatcgaggtc
gggcccgaccaggcccaggaggtctacgacaagaacctccgcatcaagcgcgcgttgcgc
cgcatcgagacgctcggcaggcccgtggtcgccgcgatcaacggcgcggcgctcggcggc
gggctggagatcgcgctcacctgccaccaccgcatcgcccttgacgcccccggatcccgt
atcggcttccccgaggtcaccctgggcctgctcccgggcagcgggggcgtcgcccgtacc
gtacggctgctcggcgtcaccgacgcgctgctcaagtggctgctccagggcacgcgctac
accccccggcgcgcccaggaggcggggctggtgcacgaggtcgccgccacccgcgaggag
atgctgaccctggcccgcgcgttcatcgccgcccaccccgagtcggcacagccctgggac
gacaaggactaccggctcccgggcggcaccccggcgcagccgaagttcgccgtcaatctg
cccgccttccccgccaatctgcgcaagcagctgaacggcgcgccctatccggcgcagcgc
aacatcctggccgccgccgtcgaggggtcccaggtggacttcgagaccgcgcagaccatc
gaggcccggtacttcaccgagctggtcgtcggccagaccgccaagaacatgattcaggcg
ttcttcttcgatctccaggcggtcaactccggtgccaaccgcccccaggggatcgagccc
cagcaggtccgcaaggtcgcggtgctgggcgccgggatgatgggcgcgggcatcgcgtac
gcctgcgccaaggcgggcatcgaggtcgtcctcaaggatgtgtccgtggaggccgccgcc
aagggcaaggcgtactccgaggggctgctggccaaggcgctcgccaagggccggaccacc
gaggcgaagcgggacgggctgctggcccggatcaccccgaccgccgacctccgcgacctc
gagggctgtgacgcggtcatcgaggcggtcttcgaggatccggcgctcaagcacaaggtg
ttccaggagatcgagggcgtcgtcgccccggacgccctgctgtgctccaacacctccacc
ctccccatcaccctgctctcggagggggtgcagcgcgcagaggacttcatcggactgcac
ttcttctcgcccgtggacaagatgccgctggtcgagatcatcaagggcgagcgcaccggc
gacaaggcgctggcccgcgccttcgatctggtgcggcagatcagcaagaccccgatcgtg
gtcaatgactcccgcgccttcttcacctcccgcgtcatcggccacttcctcaacgagggc
gtggcgatggtgggggagggcatcgccccggcctccgtggagcaggccgcggcccaggcc
ggctacccggccaaggtgctctccctgatggacgagctgaccctcaccctggcgcgcaag
atccgcgaggagacgcgccgggcgaccgaggaggcgggcggcgactggcggccgcatccg
gccgacgcggtcatcgaccgcatggtggaggagttcgggcgccccggccgcagcggcggg
gcgggcttctacgactacgacgagaccaccggccggcgcacccggctgtggccggggctg
cgggagcacttcgcgccgggcgagtccggcgagtccggcgagtccggtggttccggtggt
tccggtggctcccgtggtgagggcacccggatccccatggaggacatgaaggagcggatg
ctcttctgtgaggccatcgacacggtgcggctgctggaggagggcgtcctgacctccgtc
gccgacgccaacatcggttccatcctcggcatcggcttccccggctggacgggcggggtg
cttcagtacatcaacggatacgagggcggcgtggccggtttcgtggcccgcgcccggcag
ttggaggcggcgtacggggagcggttcgccccgcccgcgctgctgctggagaaggcggag
cggggggagcggtttatggactag

KEGG   Streptomyces malaysiensis: SMALA_7143
Entry
SMALA_7143        CDS       T05189                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00071  Fatty acid degradation
smal00280  Valine, leucine and isoleucine degradation
smal00281  Geraniol degradation
smal00310  Lysine degradation
smal00360  Phenylalanine metabolism
smal00362  Benzoate degradation
smal00380  Tryptophan metabolism
smal00410  beta-Alanine metabolism
smal00627  Aminobenzoate degradation
smal00640  Propanoate metabolism
smal00650  Butanoate metabolism
smal00903  Limonene and pinene degradation
smal00930  Caprolactam degradation
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
smal01212  Fatty acid metabolism
Module
smal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SMALA_7143
   00650 Butanoate metabolism
    SMALA_7143
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMALA_7143
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMALA_7143
   00310 Lysine degradation
    SMALA_7143
   00360 Phenylalanine metabolism
    SMALA_7143
   00380 Tryptophan metabolism
    SMALA_7143
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMALA_7143
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SMALA_7143
   00281 Geraniol degradation
    SMALA_7143
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMALA_7143
   00627 Aminobenzoate degradation
    SMALA_7143
   00930 Caprolactam degradation
    SMALA_7143
Enzymes [BR:smal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SMALA_7143
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ATL87363
UniProt: A0A291T2L0
Position
complement(8790803..8791624)
AA seq 273 aa
MTPTDGAAGPEAADAAGAPLTVRTEREGPVTTVVLSRPEVRNAVDGATATALADAFRAFD
ADPEARVAVLWGEGGAFCSGADLKAVGTPHGNRVAEGGDGPMGPTRLRLSKPVIAAVSGH
AVAGGLELALWCDLRVAEEDAVFGVFCRRWGVPLIDGGTVRLPRLIGASRAMDLVLTGRP
VAADEAYAIGLANRLVPPGRARAEAERLAAEIARFPQTCLRSDRASLLEQEGLPEDEAMA
RELRHGQTTLAEGLDGAARFAAGAGRHGSFGQL
NT seq 822 nt   +upstreamnt  +downstreamnt
gtgacgcccacggacggcgcggcgggcccggaggccgcggacgcggccggtgcgcccctt
acggttcgcaccgagcgggagggcccggtcaccacggtcgtgctctcccgccccgaggtg
cgcaacgctgtggacggcgcgaccgccacggcgctggccgacgccttccgcgccttcgac
gccgaccccgaggcgcgggtcgcggtgctgtggggcgagggcggcgccttctgctcgggc
gccgatctgaaggcggtcggcacaccgcacggcaatcgcgtggccgagggcggcgacggc
ccgatggggcccacccggctgcggctgtccaagccggtgatcgcggcggtcagcggccac
gccgtggcgggcggactggagttggcgctctggtgcgatctgcgagtcgccgaggaggac
gcggtcttcggggtgttctgccgccgctggggcgtcccgctgatcgacggcggaacggta
cggctgccacggctgatcggtgcgagccgggcgatggacctggtgctgacgggccggccg
gtggcagccgacgaggcgtacgccatcgggctcgccaaccgcctcgtaccgccggggcgg
gcgcgcgcggaggcggagcggctggcggccgagatcgcccgcttcccacagacgtgtctg
cgctcggaccgggcctcgctgctggagcaggaggggctgccggaggacgaggccatggcg
cgggagctgcgccatggccagaccacactggccgaggggctggacggcgcggcgcggttc
gcggcgggcgcgggtcggcatgggagcttcggccagctctga

KEGG   Streptomyces malaysiensis: SMALA_7393
Entry
SMALA_7393        CDS       T05189                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00071  Fatty acid degradation
smal00280  Valine, leucine and isoleucine degradation
smal00281  Geraniol degradation
smal00310  Lysine degradation
smal00360  Phenylalanine metabolism
smal00362  Benzoate degradation
smal00380  Tryptophan metabolism
smal00410  beta-Alanine metabolism
smal00627  Aminobenzoate degradation
smal00640  Propanoate metabolism
smal00650  Butanoate metabolism
smal00903  Limonene and pinene degradation
smal00930  Caprolactam degradation
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
smal01212  Fatty acid metabolism
Module
smal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SMALA_7393
   00650 Butanoate metabolism
    SMALA_7393
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMALA_7393
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMALA_7393
   00310 Lysine degradation
    SMALA_7393
   00360 Phenylalanine metabolism
    SMALA_7393
   00380 Tryptophan metabolism
    SMALA_7393
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMALA_7393
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SMALA_7393
   00281 Geraniol degradation
    SMALA_7393
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMALA_7393
   00627 Aminobenzoate degradation
    SMALA_7393
   00930 Caprolactam degradation
    SMALA_7393
Enzymes [BR:smal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SMALA_7393
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ATL87610
UniProt: A0A291T3E1
Position
complement(9168957..9169712)
AA seq 251 aa
MGVSTSAPATGVRLVAMDFPPVNALPVRGWYELAAALRTAGADPSVRCVVLAAEGRGFNA
GVDIKEIQAAEGHTALIGANHGCAEAFAAVYDCPVPVVAAVHGFCLGGGIGLAGNADAIV
ASEDATFGLPELDRGALGAATHLARLVPQHLMRALYYTSRTATAEELRRHGSVWRVVPRA
ELRETALELAGEIAAKDGALLRLAKAAINGIDPVDVRRSYRFEQGFTFEANLAGLSDGHR
DAFIAGSNGKG
NT seq 756 nt   +upstreamnt  +downstreamnt
atgggtgtctccacctccgccccggcgaccggcgtccgtctggtcgccatggacttccca
cccgtcaacgccctccccgtacggggctggtacgagctggccgcggcgctgcgcaccgcg
ggcgccgacccgtcggtgcgctgtgtggtcctggccgccgagggccgtggcttcaacgcg
ggcgtggacatcaaggagatccaggcggccgagggccatacggcgctcatcggcgccaac
cacggatgtgccgaggcgttcgccgccgtctacgactgcccggtcccggtcgtcgccgcc
gtgcacggcttctgcctgggcggcggcatcggtctcgccgggaacgccgacgcgatcgtg
gccagcgaggacgccacgttcggcctgcccgagctggaccgcggcgcgctgggcgcggcc
acccatctggcccggctggtgccgcagcatctgatgcgcgcgctgtactacacctcgcgc
accgcgaccgccgaggagctgcgccgccatggctcggtgtggcgggtcgtgccgcgcgcg
gagctgcgggagacggcgctggagctggccggtgagatcgccgccaaggacggtgcgctg
ctgcgcctggccaaggcggccatcaacggcatcgacccggtcgatgtgcgccgcagctac
cgcttcgagcagggcttcaccttcgaggccaatctggcgggcctgtcggacgggcaccgc
gacgcgttcatcgccggaagcaacgggaaggggtga

KEGG   Streptomyces malaysiensis: SMALA_7642
Entry
SMALA_7642        CDS       T05189                                 

Definition
(GenBank) 3-hydroxybutyryl-CoA dehydratase
Organism
smal  Streptomyces malaysiensis
SSDB
Motif
Pfam: ECH_1 ECH_2 ThiP_synth
Other DBs
NCBI-ProteinID: ATL87858
UniProt: A0A291T400
Position
9578849..9579610
AA seq 253 aa
MIDVERDRATGVAQLRIDRPRARNALSTEAAVRLLRAVEHTLADDAVRVLVLSGSGPDFC
VGADRDEELGNEGLAGRLRAFARLQRTVAAASKATVAAIEGRCVAAGAELAAACDIRVGA
DDSVYRFPGSSMGVPIGAAKLIGLVGLGAAKDLLLTSRWVTAQDAYRLGLLQRLVPPGRA
CAEATACATEISANDPSTTALLKSQLQRFSGVLERIDAELLAAESFPGAGRESARGADRE
TERGTDRETERGA
NT seq 762 nt   +upstreamnt  +downstreamnt
gtgatcgacgtcgaacgggaccgcgccaccggagtggcacagctgcggatcgaccgccca
cgggcccgcaacgcgctgagcaccgaggcggccgtgcggttgctccgcgccgtggagcat
acgctggccgacgacgccgtacgtgtgctcgtcctcagcggcagcggaccggacttctgt
gtcggggccgaccgcgacgaggagttggggaacgagggactcgcgggtcggctgcgggcc
ttcgcgcggttgcagcgcacggtggcggccgcctccaaggcgaccgtggccgcgatcgag
ggacgctgcgtcgccgccggtgcggagctggccgccgcctgcgacatccgggtgggggcc
gacgactcggtgtaccgcttcccgggctccagcatgggcgtccccatcggggcggccaaa
ctcatcggactggtcggcctgggcgccgccaaggatctccttctgacctcccgctgggtg
acggcacaggacgcctaccggctcgggctgttgcagcggctggtaccaccgggccgggcg
tgcgccgaggccaccgcgtgcgccaccgagatctccgccaacgacccgagcacgaccgcg
ctgctcaaaagccagctccagcgcttctccggggtgctggaacggatcgacgccgagctg
ctggccgcggagtccttcccgggcgcggggcgggaatcggcgcgaggggcggaccgggaa
acggagcgagggacggaccgggaaacggagcgaggagcatga

DBGET integrated database retrieval system