KEGG   Streptomyces malaysiensis: SMALA_0831
Entry
SMALA_0831        CDS       T05189                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00071  Fatty acid degradation
smal00280  Valine, leucine and isoleucine degradation
smal00281  Geraniol degradation
smal00310  Lysine degradation
smal00360  Phenylalanine metabolism
smal00362  Benzoate degradation
smal00380  Tryptophan metabolism
smal00410  beta-Alanine metabolism
smal00627  Aminobenzoate degradation
smal00640  Propanoate metabolism
smal00650  Butanoate metabolism
smal00903  Limonene and pinene degradation
smal00930  Caprolactam degradation
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
smal01212  Fatty acid metabolism
Module
smal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SMALA_0831
   00650 Butanoate metabolism
    SMALA_0831
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMALA_0831
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMALA_0831
   00310 Lysine degradation
    SMALA_0831
   00360 Phenylalanine metabolism
    SMALA_0831
   00380 Tryptophan metabolism
    SMALA_0831
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMALA_0831
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SMALA_0831
   00281 Geraniol degradation
    SMALA_0831
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMALA_0831
   00627 Aminobenzoate degradation
    SMALA_0831
   00930 Caprolactam degradation
    SMALA_0831
Enzymes [BR:smal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SMALA_0831
SSDB
Motif
Pfam: ECH_1 ECH_2 Pox_A3L
Other DBs
NCBI-ProteinID: ATL81066
UniProt: A0A291SJH9
Position
1165410..1166180
AA seq 256 aa
MTVTTSGQPADTDEAAADVLLVEDRGPVRVLTLNRPDKLNALNTALTRALSTALTAAEDD
GEVRAVVLTGAGRGFCAGADLSEFSTLTPDEPDAVLERAALTARLQTQMQRMGTPVVSAV
RGAAVGGGAGLAIGADMAIAGTDLKFGYPELRHSIVPALVMTGLQRHLGRKLAFELISTG
RLLSASEAAAHGLVNRVVEPDQVVEAALGTAERWAAVEPRAIHAAKDLFYRVADLPTEAA
MRAGQDVNALMRGFRR
NT seq 771 nt   +upstreamnt  +downstreamnt
gtgaccgtcacgaccagcgggcagccggccgacacggacgaagcggccgccgatgtgctg
ctcgtcgaggaccgcggcccggtccgcgtcctcaccctcaaccgccccgacaagctcaac
gcgctgaacaccgcgctcacccgggccctgagcaccgcgctcaccgcggccgaggacgac
ggcgaggtccgtgccgtcgtcctcaccggcgccggccgcggtttttgcgcgggcgccgac
ctgtcggagttctccaccctcactccggacgaaccggacgccgtcctggagcgggcggcg
ctcaccgcgcgccttcagacgcagatgcaacggatgggcacaccggtcgtctccgccgtg
cgcggcgccgcggtgggcggtggcgccgggctcgccatcggcgccgatatggccatagcc
ggcacggacctgaagttcggctaccccgaattgcggcactcgatcgtgcccgccctggtc
atgaccgggctccagcgtcacctgggccgcaagctcgccttcgaactgatcagcacgggc
cggctgctctcggcctccgaggccgcggcgcacggtctggtgaaccgcgtcgtcgaaccg
gaccaggtggtcgaggccgcgctcggcacagccgagcggtgggccgccgtggagccccgc
gccatccacgcggccaaggacctcttctaccgcgtcgccgatctgccgaccgaggccgcg
atgcgggccggacaggacgtcaacgcactgatgcgggggttccgccggtga

DBGET integrated database retrieval system