KEGG   Streptomyces malaysiensis: SMALA_2809
Entry
SMALA_2809        CDS       T05189                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA lyase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00072  Synthesis and degradation of ketone bodies
smal00280  Valine, leucine and isoleucine degradation
smal00281  Geraniol degradation
smal00650  Butanoate metabolism
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SMALA_2809
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SMALA_2809
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMALA_2809
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SMALA_2809
Enzymes [BR:smal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     SMALA_2809
SSDB
Motif
Pfam: HMGL-like
Other DBs
NCBI-ProteinID: ATL83043
UniProt: A0A291SQA0
Position
3695288..3696220
AA seq 310 aa
MTLPMTVPAPGLPARVRIHEVGPRDGLQNEKALVPAAVKAEFIHRLAEAGLTTIEATSFV
HPKWVPQLADAEELMRLIDDVDARLPVLVPNERGLDRALALGAREIAVFASATESFAKAN
LNRTVDGALEMFEPVVAKAKDAGVTVRGYLSMCFGDPWEGPVPISQTVSVSRRLLDMGCD
EISLGDTIGVATPGHVRELLATLNEAGIADDRLAVHFHDTYGQALANTLTALQHGVTTVD
ASAGGLGGCPYAKSATGNLATEDLVWMLDGLGIETGVDIGRLTATSVWMARHLGRPSPSR
TVRALSQKET
NT seq 933 nt   +upstreamnt  +downstreamnt
atgaccctccccatgaccgtcccggcccccgggctgcccgcccgggtccggatccacgag
gtgggcccgcgcgacgggctccagaacgagaaggcgctggtcccggcggccgtcaaggcg
gagttcatccaccggctcgccgaggccggtctcaccaccatcgaggccaccagcttcgtc
catcccaagtgggtgccccaactggccgacgccgaggagctgatgcggctgatcgacgac
gtggacgcccggctccccgtgctcgtgcccaatgagcgcgggctggaccgcgccctcgcg
ctgggcgcgcgcgagatcgccgtcttcgccagcgccacggagtccttcgccaaggccaat
ctcaatcgcacggtggacggcgcgctggagatgttcgaaccggtcgtcgccaaggccaag
gacgcgggcgtgaccgtgcgcggctatctgtcgatgtgcttcggcgacccgtgggagggg
ccggtcccgatctcccagaccgtctcggtcagccgccggctgctggacatgggatgcgac
gagatcagcctgggcgacaccatcggcgtggccaccccgggccatgtgcgggagctgctg
gccacgctcaacgaggcgggtatcgccgacgaccggctggccgtgcacttccacgacacc
tacggccaggcgctcgccaataccctcaccgcgctccagcacggtgtgaccaccgtcgac
gcctccgccgggggcctcggcggctgcccctacgccaagagcgccaccggcaatctcgcc
accgaagacctcgtgtggatgctggacggcctcggcatcgagaccggggtcgacatcggc
cgtctcaccgccaccagcgtgtggatggcccggcacctgggccggcccagcccgtcccgc
accgtccgcgccctctcccagaaggagacctga

DBGET integrated database retrieval system