KEGG   Streptomyces malaysiensis: SMALA_3483
Entry
SMALA_3483        CDS       T05189                                 

Definition
(GenBank) alcohol dehydrogenase GroES domain protein
  KO
K12957  alcohol/geraniol dehydrogenase (NADP+) [EC:1.1.1.2 1.1.1.183]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00010  Glycolysis / Gluconeogenesis
smal00281  Geraniol degradation
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMALA_3483
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SMALA_3483
Enzymes [BR:smal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     SMALA_3483
    1.1.1.183  geraniol dehydrogenase (NADP+)
     SMALA_3483
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ThiF 2-Hacid_dh_C AlaDh_PNT_C NAD_binding_2 ApbA XdhC_C Shikimate_DH NAD_binding_7 3HCDH_N
Other DBs
NCBI-ProteinID: ATL83717
UniProt: A0A291SS66
Position
4480319..4481329
AA seq 336 aa
MTVRAYAVERAGGPVQRLEYEPEPLGPLEVDIAVTHCGVCQTDIGMVDDVYGYSRFPVVA
GHEAVGVVEAVGSAVDGARLAVGRRVGIGAVAGACFACEWCLSGRQYLCPHKDDTVLRGE
RGAFATRLRASDWRYVQPLPEALASEHAAPLLCAGITVFSAIARNGVRPTDRVAVVGVGG
LGHLAIQFLAKWGCHVTAISSTAAKADDTRRFGAHEFIVAEEGLQRAAGSFDFILSTVSA
DLPWDAYLAALRPQGTLCVVGVPHGAFSVQPLSLLLGEKRLVGGVVGSPMENRQMLDFAA
RHGIRPAVETFPVARVDEALDHVRHGRARYRAVLEF
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgaccgtgcgcgcatacgcggtggagcgggccggtggccccgttcagcggctcgagtac
gagccggagccgctggggcccctggaggtcgacatcgccgtgacgcactgcggcgtctgc
cagaccgacatcggcatggtggacgacgtgtacggctactcccggttcccggtggtcgcg
gggcatgaggcggtcggcgtggtcgaggccgtgggcagcgccgtcgacggcgcgcggctg
gccgtcggccggcgcgtgggcatcggcgcggtggccggggcgtgcttcgcctgcgagtgg
tgtctcagcggccggcagtatctgtgcccgcacaaggacgacaccgtgctgcgcggcgag
cgcggcgcgttcgccacccggctgcgggcgagcgactggcggtatgtccagcccctgccc
gaagccctcgcctccgagcacgcggcgccactgctgtgcgccgggatcacggtgttctcg
gcgatcgcccggaacggggtacggcccacggaccgggtcgccgtggtgggggtgggcggc
ctgggccatctcgcgatccagttcctcgccaaatggggctgccatgtgaccgccatctcc
tcgacggcggcgaaggcggacgacacccgccggttcggcgcccatgagttcatcgtcgcg
gaggaggggcttcagcgggccgcgggctcgttcgacttcatcctctcgaccgtctcggcc
gatctgccgtgggacgcgtatctcgcggcgctgcgcccgcaggggacgctgtgcgtggtc
ggggttccgcacggggcgttcagcgtccagccgttgagccttctgctgggcgagaagcgg
ctcgtcggcggggtggtgggatcgccgatggagaaccggcagatgctggacttcgcggcg
cggcacggcatccgcccggccgtcgagaccttcccggtcgcgcgcgtggacgaggcgctc
gaccacgtccgccacggacgcgcgcgctaccgcgcggtgctggagttctga

DBGET integrated database retrieval system