KEGG   Streptomyces malaysiensis: SMALA_5889
Entry
SMALA_5889        CDS       T05189                                 

Definition
(GenBank) acetyl-coa acetyltransferase (thiolase)
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00071  Fatty acid degradation
smal00280  Valine, leucine and isoleucine degradation
smal00281  Geraniol degradation
smal00362  Benzoate degradation
smal00592  alpha-Linolenic acid metabolism
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
smal01212  Fatty acid metabolism
Module
smal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMALA_5889
   00592 alpha-Linolenic acid metabolism
    SMALA_5889
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMALA_5889
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SMALA_5889
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMALA_5889
   00642 Ethylbenzene degradation
    SMALA_5889
Enzymes [BR:smal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     SMALA_5889
SSDB
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Other DBs
NCBI-ProteinID: ATL86117
UniProt: A0A291SZ32
Position
complement(7258697..7259914)
AA seq 405 aa
MPRTARDVVFVDGVRTPFGKAGPKGIYHETRADDLVVKCIRELLRRNPDLPPERIDEVAI
AATTQIGDQGLTIGRTAGILAGLPQSVPGYAIDRMCAGAMTAVTTTAGSIAFGAYDAVVA
GGVEHMGRHPMGESVDPNPRFVSEKLVDESALFMGMTAENLHDRLPHISKQRADEFALRS
QEKAAKAYANGKIQQDLVPISVRRTSPEGGELGWGLATADEPMRPGTTLEGLASLKTPFR
PHGRVTAGNSAGLNDGATASLIASEDFARELGLPVRMRLVSFAFAGVEPEVMGYGPVPAT
KKALAKAGLSIEDIGLFEINEAFAVQVLSFLDHYGIADDDERVNQYGGAIAFGHPLASSG
VRLMTQLARQFEERPEVRYGITTMCIGFGMGGTVIWENPHFEGNK
NT seq 1218 nt   +upstreamnt  +downstreamnt
gtgcctcgtaccgctagggacgtcgtcttcgtcgacggcgtccggaccccattcggcaag
gcgggcccgaagggcatctaccacgagacccgcgccgacgacctggtcgtcaagtgcatc
cgggagctgctgcgccgcaacccggatctgccgccggagcgcatcgacgaggtggccatc
gccgcgacgacgcagatcggcgaccagggcctgaccatcggccgcaccgcgggcatcctg
gccgggctgccccagtcggtccccggctacgccatcgaccggatgtgcgccggtgcgatg
acggccgtgaccaccaccgcgggatccatcgccttcggtgcctacgacgccgtcgtcgcg
ggcggtgtcgagcacatgggccgccaccccatgggcgagtccgtcgaccccaacccccgc
ttcgtctcggagaagctggtcgatgagtcggccctgttcatgggcatgacggcggagaac
ctccacgaccggctgccgcatatctccaagcagcgcgccgacgagttcgcactgcgcagc
caggagaaggccgccaaggcgtacgccaacggaaagatccagcaggacctggtgccgatc
tcggtgcgccgcacctcccccgagggcggggagctgggctggggcctggccacggccgac
gagccgatgcgtccgggcaccacgctggagggcctggcctcgctgaagaccccgttccgc
ccgcacggccgggtcacggccggtaactccgcggggctcaacgacggcgccaccgcctcg
ctgatcgcctccgaggacttcgcccgggagctgggcctgccggtgcggatgcgcctggtc
tccttcgccttcgcgggcgtcgagcccgaggtgatgggctacggcccggtcccggccacc
aagaaggccctcgccaaggccggtctgtcgatcgaggacatcggcctgttcgagatcaac
gaggcgttcgccgtccaggtcctgtcgttcctggaccactacggcatcgcggacgacgat
gagcgcgtcaaccagtacggcggcgcgatcgccttcggccatccgctggcctcctccggt
gtccgcctgatgacgcagctggcacggcagttcgaggagcgccccgaggtccgctacggc
atcaccacgatgtgcatcggcttcggcatgggtggcaccgtgatctgggagaacccgcac
ttcgaggggaacaagtga

DBGET integrated database retrieval system