KEGG   Streptomyces malaysiensis: SMALA_6310
Entry
SMALA_6310        CDS       T05189                                 

Definition
(GenBank) fatty oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00071  Fatty acid degradation
smal00280  Valine, leucine and isoleucine degradation
smal00281  Geraniol degradation
smal00310  Lysine degradation
smal00362  Benzoate degradation
smal00380  Tryptophan metabolism
smal00410  beta-Alanine metabolism
smal00640  Propanoate metabolism
smal00650  Butanoate metabolism
smal00903  Limonene and pinene degradation
smal00930  Caprolactam degradation
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
smal01200  Carbon metabolism
smal01212  Fatty acid metabolism
Module
smal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SMALA_6310
   00650 Butanoate metabolism
    SMALA_6310
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMALA_6310
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMALA_6310
   00310 Lysine degradation
    SMALA_6310
   00380 Tryptophan metabolism
    SMALA_6310
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMALA_6310
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SMALA_6310
   00281 Geraniol degradation
    SMALA_6310
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMALA_6310
   00930 Caprolactam degradation
    SMALA_6310
Enzymes [BR:smal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SMALA_6310
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SMALA_6310
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SMALA_6310
SSDB
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 F420_oxidored NAD_Gly3P_dh_N NAD_binding_8 UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: ATL86538
UniProt: A0A291T058
Position
7759748..7761991
AA seq 747 aa
MTHPTTASTIRWEQDDEGVVTLVLDDPGQSANTMNAAFIDSLDAIADRAEAERESISGII
VTSAKKTFFAGGDLNDLIEVGPDQAQEVYDKNLRIKRALRRIETLGRPVVAAINGAALGG
GLEIALTCHHRIALDAPGSRIGFPEVTLGLLPGSGGVARTVRLLGVTDALLKWLLQGTRY
TPRRAQEAGLVHEVAATREEMLTLARAFIAAHPESAQPWDDKDYRLPGGTPAQPKFAVNL
PAFPANLRKQLNGAPYPAQRNILAAAVEGSQVDFETAQTIEARYFTELVVGQTAKNMIQA
FFFDLQAVNSGANRPQGIEPQQVRKVAVLGAGMMGAGIAYACAKAGIEVVLKDVSVEAAA
KGKAYSEGLLAKALAKGRTTEAKRDGLLARITPTADLRDLEGCDAVIEAVFEDPALKHKV
FQEIEGVVAPDALLCSNTSTLPITLLSEGVQRAEDFIGLHFFSPVDKMPLVEIIKGERTG
DKALARAFDLVRQISKTPIVVNDSRAFFTSRVIGHFLNEGVAMVGEGIAPASVEQAAAQA
GYPAKVLSLMDELTLTLARKIREETRRATEEAGGDWRPHPADAVIDRMVEEFGRPGRSGG
AGFYDYDETTGRRTRLWPGLREHFAPGESGESGESGGSGGSGGSRGEGTRIPMEDMKERM
LFCEAIDTVRLLEEGVLTSVADANIGSILGIGFPGWTGGVLQYINGYEGGVAGFVARARQ
LEAAYGERFAPPALLLEKAERGERFMD
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgacccaccccacgacggcctcgaccatccgctgggagcaggacgacgaaggcgtcgtc
accctggtgctcgacgaccccggccagtccgccaacaccatgaacgccgcgttcatcgac
tccctcgacgcgatcgccgaccgcgccgaggccgagcgcgagtcgatcagcggcatcatc
gtcacctccgccaagaagaccttcttcgccggtggcgacctcaacgacctcatcgaggtc
gggcccgaccaggcccaggaggtctacgacaagaacctccgcatcaagcgcgcgttgcgc
cgcatcgagacgctcggcaggcccgtggtcgccgcgatcaacggcgcggcgctcggcggc
gggctggagatcgcgctcacctgccaccaccgcatcgcccttgacgcccccggatcccgt
atcggcttccccgaggtcaccctgggcctgctcccgggcagcgggggcgtcgcccgtacc
gtacggctgctcggcgtcaccgacgcgctgctcaagtggctgctccagggcacgcgctac
accccccggcgcgcccaggaggcggggctggtgcacgaggtcgccgccacccgcgaggag
atgctgaccctggcccgcgcgttcatcgccgcccaccccgagtcggcacagccctgggac
gacaaggactaccggctcccgggcggcaccccggcgcagccgaagttcgccgtcaatctg
cccgccttccccgccaatctgcgcaagcagctgaacggcgcgccctatccggcgcagcgc
aacatcctggccgccgccgtcgaggggtcccaggtggacttcgagaccgcgcagaccatc
gaggcccggtacttcaccgagctggtcgtcggccagaccgccaagaacatgattcaggcg
ttcttcttcgatctccaggcggtcaactccggtgccaaccgcccccaggggatcgagccc
cagcaggtccgcaaggtcgcggtgctgggcgccgggatgatgggcgcgggcatcgcgtac
gcctgcgccaaggcgggcatcgaggtcgtcctcaaggatgtgtccgtggaggccgccgcc
aagggcaaggcgtactccgaggggctgctggccaaggcgctcgccaagggccggaccacc
gaggcgaagcgggacgggctgctggcccggatcaccccgaccgccgacctccgcgacctc
gagggctgtgacgcggtcatcgaggcggtcttcgaggatccggcgctcaagcacaaggtg
ttccaggagatcgagggcgtcgtcgccccggacgccctgctgtgctccaacacctccacc
ctccccatcaccctgctctcggagggggtgcagcgcgcagaggacttcatcggactgcac
ttcttctcgcccgtggacaagatgccgctggtcgagatcatcaagggcgagcgcaccggc
gacaaggcgctggcccgcgccttcgatctggtgcggcagatcagcaagaccccgatcgtg
gtcaatgactcccgcgccttcttcacctcccgcgtcatcggccacttcctcaacgagggc
gtggcgatggtgggggagggcatcgccccggcctccgtggagcaggccgcggcccaggcc
ggctacccggccaaggtgctctccctgatggacgagctgaccctcaccctggcgcgcaag
atccgcgaggagacgcgccgggcgaccgaggaggcgggcggcgactggcggccgcatccg
gccgacgcggtcatcgaccgcatggtggaggagttcgggcgccccggccgcagcggcggg
gcgggcttctacgactacgacgagaccaccggccggcgcacccggctgtggccggggctg
cgggagcacttcgcgccgggcgagtccggcgagtccggcgagtccggtggttccggtggt
tccggtggctcccgtggtgagggcacccggatccccatggaggacatgaaggagcggatg
ctcttctgtgaggccatcgacacggtgcggctgctggaggagggcgtcctgacctccgtc
gccgacgccaacatcggttccatcctcggcatcggcttccccggctggacgggcggggtg
cttcagtacatcaacggatacgagggcggcgtggccggtttcgtggcccgcgcccggcag
ttggaggcggcgtacggggagcggttcgccccgcccgcgctgctgctggagaaggcggag
cggggggagcggtttatggactag

DBGET integrated database retrieval system