KEGG   Streptomyces malaysiensis: SMALA_7143
Entry
SMALA_7143        CDS       T05189                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00071  Fatty acid degradation
smal00280  Valine, leucine and isoleucine degradation
smal00281  Geraniol degradation
smal00310  Lysine degradation
smal00360  Phenylalanine metabolism
smal00362  Benzoate degradation
smal00380  Tryptophan metabolism
smal00410  beta-Alanine metabolism
smal00627  Aminobenzoate degradation
smal00640  Propanoate metabolism
smal00650  Butanoate metabolism
smal00903  Limonene and pinene degradation
smal00930  Caprolactam degradation
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal01120  Microbial metabolism in diverse environments
smal01212  Fatty acid metabolism
Module
smal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SMALA_7143
   00650 Butanoate metabolism
    SMALA_7143
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SMALA_7143
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SMALA_7143
   00310 Lysine degradation
    SMALA_7143
   00360 Phenylalanine metabolism
    SMALA_7143
   00380 Tryptophan metabolism
    SMALA_7143
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMALA_7143
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SMALA_7143
   00281 Geraniol degradation
    SMALA_7143
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SMALA_7143
   00627 Aminobenzoate degradation
    SMALA_7143
   00930 Caprolactam degradation
    SMALA_7143
Enzymes [BR:smal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SMALA_7143
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: ATL87363
UniProt: A0A291T2L0
Position
complement(8790803..8791624)
AA seq 273 aa
MTPTDGAAGPEAADAAGAPLTVRTEREGPVTTVVLSRPEVRNAVDGATATALADAFRAFD
ADPEARVAVLWGEGGAFCSGADLKAVGTPHGNRVAEGGDGPMGPTRLRLSKPVIAAVSGH
AVAGGLELALWCDLRVAEEDAVFGVFCRRWGVPLIDGGTVRLPRLIGASRAMDLVLTGRP
VAADEAYAIGLANRLVPPGRARAEAERLAAEIARFPQTCLRSDRASLLEQEGLPEDEAMA
RELRHGQTTLAEGLDGAARFAAGAGRHGSFGQL
NT seq 822 nt   +upstreamnt  +downstreamnt
gtgacgcccacggacggcgcggcgggcccggaggccgcggacgcggccggtgcgcccctt
acggttcgcaccgagcgggagggcccggtcaccacggtcgtgctctcccgccccgaggtg
cgcaacgctgtggacggcgcgaccgccacggcgctggccgacgccttccgcgccttcgac
gccgaccccgaggcgcgggtcgcggtgctgtggggcgagggcggcgccttctgctcgggc
gccgatctgaaggcggtcggcacaccgcacggcaatcgcgtggccgagggcggcgacggc
ccgatggggcccacccggctgcggctgtccaagccggtgatcgcggcggtcagcggccac
gccgtggcgggcggactggagttggcgctctggtgcgatctgcgagtcgccgaggaggac
gcggtcttcggggtgttctgccgccgctggggcgtcccgctgatcgacggcggaacggta
cggctgccacggctgatcggtgcgagccgggcgatggacctggtgctgacgggccggccg
gtggcagccgacgaggcgtacgccatcgggctcgccaaccgcctcgtaccgccggggcgg
gcgcgcgcggaggcggagcggctggcggccgagatcgcccgcttcccacagacgtgtctg
cgctcggaccgggcctcgctgctggagcaggaggggctgccggaggacgaggccatggcg
cgggagctgcgccatggccagaccacactggccgaggggctggacggcgcggcgcggttc
gcggcgggcgcgggtcggcatgggagcttcggccagctctga

DBGET integrated database retrieval system