KEGG   Streptomyces malaysiensis: SMALA_8257Help
Entry
SMALA_8257        CDS       T05189                                 

Definition
(GenBank) non-hemolytic phospholipase C precursor
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00562  Inositol phosphate metabolism
smal00564  Glycerophospholipid metabolism
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
smal02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    SMALA_8257
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SMALA_8257
   00565 Ether lipid metabolism
    SMALA_8257
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SMALA_8257
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:smal02042]
    SMALA_8257
Enzymes [BR:smal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     SMALA_8257
Bacterial toxins [BR:smal02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   SMALA_8257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal
Motif
Other DBs
NCBI-ProteinID: ATL88466
UniProt: A0A291T5Q5
Position
complement(10335831..10337903)
Genome map
AA seq 690 aa AA seqDB search
MVRNPNIPKPESEPGDRPETTTGATRRRFLQGAGVAAGTLVLGGTAGASGAYAASNPGYV
LPKGFQGDMSDLRHVVILMQENRSLDHYFGTFPGVRGFNDKQALRFQDGTTVFQQKDRNG
NIVTPKADDGTWGNNHEAWGDVDHRKWDLWVQHNGASCMNYHSDAYMGFYHAIAAQYTIA
DQNFCSEFGPTDPNRKYLWSGTANSETGNTDESNYSRPWITVAEQLQQVGIDWRLYSDNS
GNGRQGYISTWVGDYGDNELKYFKGFDPQGLSADDPKLRPGTGLIWRGNATYYSGKTSPN
DDSDANLDAVLKNLHDACRPGAEHPLPAVSWIVAPYGWSEHPSADTLHGERYVKKTLDIL
QSNPDIWNATLFILNYDENDGKFDHVLPPWPEAGTAGEYTGDYPLGFGPRVPMLLVSPWT
RGGYVASEVFDHTSTIKFLEIWAAHLGKPFRCPNISDWRRSIAGDLTSALDFAHPQPGPA
ALPDPRSERPVSIAADHMKARPLSFHPHATISEDRASGTVTARMTLTGGPKDKALSFQVF
PDKYKAFSSTPFTVAARKPRDYTWDANATDGKYAFSIYSNDGFVRSFAGQVAPAGKTDGA
LPRVEVALLRGEGITQEAQVKLTLHNDGTEPVDYTLTAHDYLGRTRNVTVAPGRTKVVMW
PTQQGYYDVVITVNTDTTWKQRYAGRIATI
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
gtggttcgcaatccgaatatccccaagcccgagtccgagcccggcgacagacccgagacg
acgaccggcgccacccgccgtcgcttcctccagggcgcgggggtcgccgccgggacgctg
gtgctcggcgggaccgccggggcgagcggcgcctacgccgcctcgaaccccgggtacgtc
ttgccaaagggcttccagggcgacatgtccgacctgaggcatgtcgtgatcctgatgcag
gagaaccggtccctcgaccactacttcggcacgttccccggtgtacgcggcttcaatgac
aagcaggcgctccggttccaggacggcaccaccgtcttccagcagaaggaccgcaacggc
aacatcgtcaccccgaaggccgatgacggcacctggggcaacaaccacgaagcctggggc
gacgtcgaccatcgcaagtgggatctgtgggttcagcacaacggcgccagctgcatgaac
taccacagcgacgcctacatgggcttctaccatgcgatcgccgcccagtacaccatcgcg
gaccagaacttctgctccgagttcgggccgaccgaccccaaccggaagtacctgtggagc
ggcaccgccaacagcgagacgggcaacaccgacgagtccaactactcccgtccctggatc
acggtggccgagcagctccagcaggtcggcatcgactggcggctctactccgacaacagc
ggcaacgggcgacagggttacatcagcacctgggtcggcgactacggcgacaacgagctg
aagtacttcaaggggttcgacccgcaggggctgagtgccgacgacccgaagctgcggccc
ggcaccggcctgatctggcgcggcaacgccacgtactactccggcaagacctcaccgaat
gacgactccgacgcgaacctcgacgcggtcctcaagaacctccatgacgcctgccggccg
ggcgcggaacacccgctgccggccgtctcctggatcgtggcgccctacggctggtccgag
cacccgagcgcggacacgctgcacggcgagcgctacgtcaagaagacgctcgacatcctc
cagagcaaccccgacatctggaatgccaccctcttcatcctcaactacgacgagaacgac
gggaagttcgaccacgtgctgccgccctggcccgaggcgggcacggcgggcgagtacacc
ggcgactatccgctcggcttcggtccgcgggtgccgatgctgctggtctcgccgtggacc
cgcggcgggtacgtcgcctcggaggtcttcgaccacacctcgacgatcaagttcctcgag
atctgggcggcccacctcggcaagccgttccgctgccccaacatcagcgactggcggcgc
tcgatcgcaggtgacctgaccagcgccctggacttcgcccacccgcaaccggggccggcc
gccctcccggacccgcgctccgagcggccggtgtcgatcgccgccgaccatatgaaggcg
cgcccgctgagcttccacccgcacgcgacgatctcggaggaccgcgcgtcgggcacggtc
accgccaggatgaccctgaccggcggcccgaaggacaaggccctgagcttccaggtcttc
cccgacaagtacaaggcgttctccagcacgccgttcaccgtcgccgcgcgcaagccccgc
gactacacctgggacgccaacgccaccgacggcaagtacgcgttctcgatctactccaac
gacggcttcgtgcgctccttcgccggccaggtcgcgcccgccggaaagacggacggtgcc
ctcccgcgggtcgaggtcgccctgctgaggggcgagggcatcacacaagaggcccaggtg
aagctcacattgcacaacgacggcaccgagccggtggactacaccctcaccgcccatgac
tacctcggccgtacccggaacgtcaccgtggcccccggccggacgaaggtcgtcatgtgg
cccacccagcagggctactacgacgtggtcatcacggtgaacaccgacaccacctggaag
cagcgctacgcggggcggatcgccaccatctga

DBGET integrated database retrieval system