KEGG   Streptomyces malaysiensis: SMALA_8334Help
Entry
SMALA_8334        CDS       T05189                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00450  Selenocompound metabolism
smal00970  Aminoacyl-tRNA biosynthesis
smal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SMALA_8334
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SMALA_8334
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:smal01007]
    SMALA_8334
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:smal03016]
    SMALA_8334
Enzymes [BR:smal01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SMALA_8334
Amino acid related enzymes [BR:smal01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SMALA_8334
Transfer RNA biogenesis [BR:smal03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SMALA_8334
 Prokaryotic type
   Other AARSs
    SMALA_8334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ATL88543
UniProt: A0A291T5V8
Position
complement(10480723..10482312)
Genome map
AA seq 529 aa AA seqDB search
MSAPVWITATPPTPNGDLHIGHIAGPYVAGDVLRRFLAADGTEVRYTTGLDDHQSYVPVR
GLKDGGRTGEEVADSYGASIARVWQRTEVGFDRVVRPREEDGYLAYVQDFLRRLHDAGHV
VARTRPLPYCAPCERWLYEAYLTGKCPHCGSSSNGNACEPCGRPNDCADLGEPRCTICDT
PAEIRDAARLYFPLAPFADRLEAFWAEVDMPPHLRALCDRMLAHGLPEIAVSHPGEWGVP
VTVPGFEDQRAYVWFEMAPGYLWELPEQEREKGDWPAPVQFFGFDNGYFHAVLFPALYAA
LHPGAALARAFVVNEFYQLDGAKFSTSRRHAIWVHEALAEAGSDVLRHHVLADRPNGRQT
SFTRTDLERTQALLTAQWNGWLEQLFAAVAHHSDGRVPEERPEGPAWQRLRAWLERTVAE
LREAYGVEGFDTRRVVALLDEIVAGANDFWYVHEHERDRSPSAHRAALTAQLTVAGALSA
WAAPVMPAGAARLAALLGEDADRAVDAAALTPPPAGRPLTVPDRPVFGD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgctccggtctggatcaccgccaccccgcccacccccaacggcgacctccacatc
ggtcacatcgccggaccctacgtcgccggcgacgtactgcgccgcttcctcgccgccgac
gggaccgaggtccgctacaccaccggcctggacgaccaccagagctatgtcccggtgcgc
ggtctgaaggacggcgggcgcaccggcgaggaggtcgccgacagctacggcgcgtccatc
gcccgggtctggcagcggaccgaggtcggtttcgaccgcgtggtgcgtccgcgcgaggag
gacggctacctcgcctacgtccaggacttcctgcgccgcctccacgacgccgggcacgtc
gtcgcccgtacccggccgctgccgtactgcgccccgtgcgagcgctggctgtacgaggcg
tacctgacgggcaaatgcccgcactgcggctcctcgtccaacggcaacgcctgcgagccg
tgcggccggcccaacgactgcgccgatctgggcgagccgcggtgcaccatctgcgacacc
ccggccgagatccgcgacgccgcccggctgtacttcccgctggcaccgttcgccgaccgg
ctggaggcgttctgggcagaggtggacatgccgccgcatctgcgggccctgtgcgaccgg
atgcttgcccacgggctgccggagatcgcggtgagccaccccggcgagtggggcgtgccg
gtgaccgtgcccggcttcgaggaccagcgggcctatgtgtggttcgagatggcgcctggc
tatctgtgggagctgcccgaacaggagcgggagaagggcgactggcccgcccccgtgcag
ttcttcggcttcgacaacggctacttccacgcggtgctgttccccgccctgtacgccgcc
ctgcaccccggggccgccctggcgcgggcgttcgtggtcaacgagttctaccagctggac
ggggcgaagttctcgaccagccgacggcacgccatctgggtccacgaggcgctcgccgag
gccggctccgacgtcctgcgccaccatgtgctcgccgaccggcccaacggccgccagacc
agcttcacccgcacggacctggaacgcacccaggcgctgctgaccgcccagtggaacggc
tggctggagcagctcttcgcggcggtcgcccaccacagcgacggccgggtccccgaggaa
aggcccgagggacccgcctggcagcggctgcgggcctggctggagcgcaccgtggcggag
ctgcgcgaggcatacggcgtcgagggcttcgacacacgccgtgtcgtcgccctcctcgac
gagatcgtcgccggcgcgaacgacttctggtacgtccacgagcacgagcgggaccggtcg
ccctccgcgcaccgtgccgccctgaccgcccaactgaccgtcgccggcgccctgtcggcg
tgggccgcgcccgtcatgccggccggcgcggcacggctcgccgcgctgctgggcgaggac
gcggaccgggcggtcgacgcggccgcgctgaccccgcccccggcgggccggccgctgacc
gtgcccgaccgcccggtcttcggtgactga

DBGET integrated database retrieval system