KEGG   Streptomyces malaysiensis: SMALA_8410Help
Entry
SMALA_8410        CDS       T05189                                 

Definition
(GenBank) ornithine cyclodeaminase/mu-crystallin
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00998  Biosynthesis of secondary metabolites - other antibiotics
smal00999  Biosynthesis of secondary metabolites - unclassified
smal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    SMALA_8410
   00999 Biosynthesis of secondary metabolites - unclassified
    SMALA_8410
Enzymes [BR:smal01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     SMALA_8410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall HD
Motif
Other DBs
NCBI-ProteinID: ATL88619
UniProt: A0A291T664
Position
complement(10555323..10555619)
Genome map
AA seq 98 aa AA seqDB search
MSTLAPPPLTVIGAGDIAAETDRHRTELVEVVRAAYLTHDAGDSANPHSSFLRFPHQERS
RIISLPAYLGGAFEVAGNKWIASFPDNTRHGSPARRPR
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaccctggctccgccgcccctgaccgtgatcggggcgggcgacatcgccgccgag
acggaccgccaccgtacggagctcgtcgaggtcgtccgtgccgcctacctcacgcacgac
gccggtgacagcgcgaacccgcacagctcgttcctgcgcttcccgcaccaggaacggtcg
cgcatcatctcgctgccggcctatctgggcggcgcgttcgaggtcgccggcaacaagtgg
atcgccagctttccggacaacacacggcacgggtcccccgcgcgtcggccacgctga

DBGET integrated database retrieval system