KEGG   Serratia marcescens SM39: SM39_0037Help
Entry
SM39_0037         CDS       T03592                                 

Gene name
apaG
Definition
(GenBank) protein associated with Co2+ and Mg2+ efflux
  KO
K06195  ApaG protein
Organism
smar  Serratia marcescens SM39
Brite
KEGG Orthology (KO) [BR:smar00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SM39_0037 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: BAO32107
Position
complement(42725..43102)
Genome map
AA seq 125 aa AA seqDB search
MIDSPRVCIQVQSIYVESQSIPEEERYVFAYTITIRNLGRTDVQLLGRYWLITNSNGRQT
EVQGEGVIGEQPVIPPGGEFQYTSGAILETPLGTMEGHYEMVDHQGQPFRTAIPVFRLAI
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgattcgccccgcgtgtgtattcaggttcagagcatctatgtggaatcacagtcg
atccctgaagaagagcgttacgtcttcgcctataccatcaccatccgcaatctggggcgg
accgacgtgcaactgctgggccgttactggctgatcaccaacagcaacggccgccaaact
gaagttcagggcgaaggcgtgatcggcgaacagcccgtcattccgcccggcggagagttt
cagtacaccagcggcgccattctggaaacgccgctgggcaccatggaaggccattacgaa
atggttgaccaccagggtcagccgttccgcaccgctattcccgtgtttcgcttagccatt
ccaacgctgatccattaa

DBGET integrated database retrieval system