KEGG   Serratia marcescens SM39: SM39_1096Help
Entry
SM39_1096         CDS       T03592                                 

Definition
(GenBank) 4-hydroxy-L-threonine phosphate dehydrogenase, NAD-dependent
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
smar  Serratia marcescens SM39
Brite
KEGG Orthology (KO) [BR:smar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SM39_1096
Enzymes [BR:smar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     SM39_1096
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     SM39_1096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: BAO33144
Position
1122165..1123166
Genome map
AA seq 333 aa AA seqDB search
MTLSTLPLAITMGDPAGIGPEIIAKLAATERLSTPYVVIGDAGALARAAASLGLTLHIRE
LPASLAGWDEAWRRGETAVYSAGVALPADLPLGRLDKRAGAASYAWVVAAIDLALTGRIA
GIVTAPLNKEAMRLAGIDYPGHTEILAARSGTQDFAMMLANDELRVILVSIHVSLRDAID
AATVENELRAFHLAQTACRALGIAKPRIAVAGLNPHAGENGLFGREDLDVIVPAITLARE
QGLDVSGPWPGDTVFMRARRGEFDIVVAQYHDQGLIPVKYLGVDHGVNVTVGLPFIRTSV
DHGTAFDIAGSGRAEHASLLYAFRQAEKMLRAQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaccctttccaccttgccgctggcgataacgatgggcgatcccgccggcatcgggccg
gagatcatcgccaaactggcggccacagagcggttgagcacgccttatgtggtgattggc
gatgccggtgccctggcgcgcgcggcggccagtctggggctgacgttgcacatccgcgag
ctgcccgcctcgctggcgggatgggacgaagcctggcggcggggggagaccgccgtctat
tccgccggcgttgcgctgccggcggacttgcccctcggcaggctcgataagcgcgcgggc
gcggcgtcttatgcctgggtggttgccgccatcgatctggcgctgacggggcgcatcgcc
ggcatcgtcactgcgccgctgaacaaggaagcgatgcgcctggcggggatcgattatccg
gggcacaccgagatcctggcggcgcgctcgggcacccaggacttcgccatgatgctggcc
aacgacgagctgcgggtgatcctggtttccattcacgtttcgctgcgggacgccatcgac
gcggcgaccgtggaaaatgagctgcgcgcgtttcatctggcgcaaacggcctgccgggcg
ttgggcatagcgaaaccgcgcattgcggtggccggcctgaatccgcacgccggggagaac
ggcctgttcggccgcgaagatcttgacgtcatcgtgcccgccatcaccctggcgcgggaa
caggggttggacgtcagcggcccctggcccggcgataccgttttcatgcgcgcccggcgc
ggggagttcgacattgtggtcgcccaatatcacgaccagggcctgatcccggtgaaatat
ctcggggtggatcacggcgttaacgtcaccgtcggcctgccgtttatccgcacctcggtc
gaccacggtacggcgttcgatattgcgggcagcggacgggcggaacacgccagcctgctg
tacgccttccggcaggcggaaaaaatgctgcgcgcccaataa

DBGET integrated database retrieval system