KEGG   Serratia marcescens SM39: SM39_1395Help
Entry
SM39_1395         CDS       T03592                                 

Gene name
nagZ
Definition
(GenBank) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
smar  Serratia marcescens SM39
Pathway
smar00520  Amino sugar and nucleotide sugar metabolism
smar01100  Metabolic pathways
smar01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:smar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SM39_1395 (nagZ)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SM39_1395 (nagZ)
Enzymes [BR:smar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SM39_1395 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Acetyltransf_5
Motif
Other DBs
NCBI-ProteinID: BAO33440
Position
1418336..1419367
Genome map
AA seq 343 aa AA seqDB search
MGPVMLDVAGYELDAEEREILKHPLVGGLILFTRNFHDAEQLRELVRQIRAASHDRLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALHDVQEGGRLAQEAGWLMAAEMIAQDIDISFAPV
LDIGHGSAAIGERSFHSDPQQALAMAERFILGMHSAGMKTTGKHFPGHGAVSADSHKETP
RDPRPLAQIREHDMAIFRELINRQLLDAVMPAHVIYTEADPRPASGSPYWLQQILRQELG
FDGVIFSDDLSMEGAAIMGSYAERGQAALDAGCDMILVCNHREGAVSVLDNLSPVKAEKV
KRLYHRGQFTRQELRDSERWQQAHKALSALSERWEEHKQRSQG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgggcccagtaatgctagatgtcgccggctacgagctggatgcagaagaacgcgagatt
ctgaaacacccgctggttggcggattgatcctgtttacccgcaacttccacgatgcggag
cagttgcgtgagctggtgcgccagatccgcgccgcctcgcacgatcggctggtggtggcg
gtagaccaggagggcgggcgcgtgcagcgcttccgcgagggcttcacccgcctgccggcg
gcgcagtcgttcgccgcgttgcacgatgtgcaggaaggcggccggctggcgcaggaggcc
ggctggctgatggcggcggaaatgatcgcgcaggatatcgacatcagcttcgcgccggtg
ctggacatcggccacggcagcgcggcgatcggcgagcgttcgttccacagcgatccgcag
caggcgctggcgatggcggaacgctttatcctcggcatgcacagcgccggcatgaaaacc
accggcaaacacttccctgggcacggcgccgtcagcgccgattcgcacaaggaaaccccg
cgcgatccgcggccgctggcgcagatccgcgaacatgacatggcgatcttccgcgagctg
atcaaccgccagctgctggacgccgtcatgccggcccacgtcatctatactgaagcggac
ccgcgcccggccagcggctcgccttactggctgcagcagatcctgcgtcaggagctgggc
ttcgacggcgtgattttctccgacgatctgtcgatggaaggcgccgccatcatgggcagc
tacgccgagcgcggccaggcggcgctggatgccggttgcgacatgatcctggtgtgcaac
caccgcgaaggtgcggtcagcgtgttggataacctgtccccggtcaaagcagagaaggtg
aagcggttatatcatcgcggtcagttcacccgtcaggaactgcgcgactccgagcgctgg
cagcaggcgcacaaggcgcttagcgcgctgagcgaacgctgggaggagcacaagcagcgt
tcgcaggggtga

DBGET integrated database retrieval system