KEGG   Serratia marcescens SM39: SM39_2930Help
Entry
SM39_2930         CDS       T03592                                 

Gene name
ubiX
Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
smar  Serratia marcescens SM39
Pathway
smar00130  Ubiquinone and other terpenoid-quinone biosynthesis
smar00627  Aminobenzoate degradation
smar01100  Metabolic pathways
smar01110  Biosynthesis of secondary metabolites
smar01120  Microbial metabolism in diverse environments
smar01220  Degradation of aromatic compounds
Module
smar_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:smar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SM39_2930 (ubiX)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SM39_2930 (ubiX)
Enzymes [BR:smar01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     SM39_2930 (ubiX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: BAO34909
Position
complement(3006076..3006648)
Genome map
AA seq 190 aa AA seqDB search
MKRLIIGISGASGAIYGVRLLQVLRDVAEVETHLVMSNAARQTLALETPYSLREVQALAD
VVHDARDIAAGISSGSFKTLGMAILPCSVKTLSGIVNSYSDGLLTRAADVVLKERRRLVL
CVRETPLHLGHLRLMTQAAEMGAVIMPPVPAFYHQPKSVEDIIDQTVNRVIDQFDIELPA
DLFTRWQGVS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgactcatcatcggcatttccggcgccagcggcgccatctacggcgtgcgcctg
ttacaggttttgcgcgacgtcgcagaggtggaaacccatctggtgatgagcaacgcggca
agacagacgctggcgctggaaacgccgtacagcctgcgggaagtgcaggcgctggccgac
gtggtgcacgatgcgcgcgacatcgccgccggcatctcctccggctccttcaaaaccctg
ggcatggcgatcctgccatgctcagtcaaaacgctgtccggcatcgtcaacagttacagc
gacgggctgctgacccgcgccgccgacgtggtgctcaaagagcgccgtcgcctggtattg
tgcgtgcgtgaaacgccgctgcatttgggtcacctgcggttgatgacccaggcggcggag
atgggggcggtgatcatgccgccggtgccggcgttttatcaccagccgaaaagcgtggaa
gacatcatcgatcagaccgtcaatcgggtgatcgatcagtttgatatcgaactgcctgcc
gatctgttcacccgttggcagggcgttagttaa

DBGET integrated database retrieval system