KEGG   Serratia marcescens SM39: SM39_3672Help
Entry
SM39_3672         CDS       T03592                                 

Gene name
scrB
Definition
(GenBank) intracellular alpha-D-fructohydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
smar  Serratia marcescens SM39
Pathway
smar00052  Galactose metabolism
smar00500  Starch and sucrose metabolism
smar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SM39_3672 (scrB)
   00500 Starch and sucrose metabolism
    SM39_3672 (scrB)
Enzymes [BR:smar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     SM39_3672 (scrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: BAO35619
Position
3793182..3794591
Genome map
AA seq 469 aa AA seqDB search
MEELSLIKQALRAVMNGQTRALRDPHRPAWHLAPSVGLLNDPNGFIQHNGVYHLFYQWNP
LGCDHRNKCWGHWQSTDLLRWEHQPIALAPGACYDSHGCYSGSAVVAEDKITLIYTGNVK
FPDGSRTAYQCLAQESDRGEYRKLGPVLPLPEGYSGHVRDPKVWRHQDAWYMVLGARDLQ
DRGKVLLLRSCDLRDWQAQGEIAGSGLNDLGEFGYIWECPDLFSLDGDDVLICCPQGLAP
QPERYLNRYQAGYLLGKLDYRQAAFSHGEFRELDAGFEFYAPQTTLAEDGRRLLFGWMGV
PEQDEEAHPTRRYGWIHTMTCPRELSLRHGRLHQRPARELQQLRGEREDWQGRADDAPTY
ALGAAELQLTPQGAFSAAFGDAMTLSWDGERLQLTRASLADGRPEHRYWRGPVTHLQLLF
DRSSVEIFINHGEAVMSARYFPAAEPQLRLNGSAPLALEYWPLTPCMLE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactcagcttaatcaaacaggcgctgcgggcggtaatgaacggccagacacgc
gcactgcgcgatccgcaccgcccggcctggcatctggcgcccagcgttggcttgctgaac
gatcctaacggctttatccagcacaacggcgtttatcacctgttctatcagtggaacccg
ctgggctgcgatcatcgcaacaagtgctggggacactggcaatcgaccgatttattgcgt
tgggaacatcagccgatcgccctggcgccgggcgcctgttacgacagccacggctgttac
tccggctcggcggtggtggcggaagacaaaatcacgctgatctacaccggcaacgtgaaa
ttccccgacggctcgcgcaccgcttaccaatgcctggctcaggaaagcgatcggggcgaa
taccgcaaactcgggccggtgctgccgctgccggagggctacagcggccacgtacgcgat
ccgaaagtgtggcgtcatcaggatgcctggtacatggtgctcggcgcgcgtgacttgcag
gatcgcggcaaggtgctgctgctgcgttcctgcgatctgcgcgactggcaagcgcagggg
gagatcgccggttccggcctgaacgacctgggtgaattcggctacatctgggagtgcccg
gacctgttctcgctggacggcgacgacgtgttgatctgctgcccgcaggggctggcgccg
cagccggaacgctatctcaaccgttatcaggccggctatctgctcggtaagctggattac
cggcaggcggccttcagccacggcgaatttcgcgagctggacgccggcttcgagttctac
gcgccccagacgacgctggcggaagatggccgccgcctgctgttcggctggatgggcgtg
cccgagcaagatgaagaagcccatccgacgcgccgttacggctggatccacaccatgacc
tgcccacgcgagctgtcgctgcggcatggccgcctccaccaacgcccggcgcgcgagctg
caacagctgcgcggcgagcgagaagactggcaaggccgcgccgatgacgcccccacctat
gcgctgggcgccgcggagctgcagctgacgccgcagggcgcgttcagcgccgcctttggc
gacgccatgacgctgagctgggacggcgaacggctgcagctgacgcgtgcttccctggcc
gacggtaggccggagcaccgttactggcgcggtccggtcacgcatctgcagctgctgttc
gatcgttccagcgtggaaatcttcatcaaccacggcgaggcggtgatgagcgcgcgctac
ttcccggcagctgaaccgcaactgcggctgaacgggagcgcgccgctggcgttggaatac
tggccgctgacgccatgcatgctagaatga

DBGET integrated database retrieval system