KEGG   Serratia marcescens SM39: SM39_4920Help
Entry
SM39_4920         CDS       T03592                                 

Definition
(GenBank) acetoacetate-CoA transferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smar  Serratia marcescens SM39
Pathway
smar00071  Fatty acid degradation
smar00072  Synthesis and degradation of ketone bodies
smar00280  Valine, leucine and isoleucine degradation
smar00310  Lysine degradation
smar00362  Benzoate degradation
smar00380  Tryptophan metabolism
smar00620  Pyruvate metabolism
smar00630  Glyoxylate and dicarboxylate metabolism
smar00640  Propanoate metabolism
smar00650  Butanoate metabolism
smar00900  Terpenoid backbone biosynthesis
smar01100  Metabolic pathways
smar01110  Biosynthesis of secondary metabolites
smar01120  Microbial metabolism in diverse environments
smar01130  Biosynthesis of antibiotics
smar01200  Carbon metabolism
smar01212  Fatty acid metabolism
smar02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SM39_4920
   00630 Glyoxylate and dicarboxylate metabolism
    SM39_4920
   00640 Propanoate metabolism
    SM39_4920
   00650 Butanoate metabolism
    SM39_4920
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SM39_4920
   00072 Synthesis and degradation of ketone bodies
    SM39_4920
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SM39_4920
   00310 Lysine degradation
    SM39_4920
   00380 Tryptophan metabolism
    SM39_4920
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SM39_4920
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SM39_4920
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SM39_4920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smar04147]
    SM39_4920
Enzymes [BR:smar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SM39_4920
Exosome [BR:smar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SM39_4920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: BAO36816
Position
5119550..5120734
Genome map
AA seq 394 aa AA seqDB search
MQQREVVIVAATRTPVGSFHGALAPLTAVELGTAAVQGLLAQSGVAPQQIDEVILGQVLT
AGCGQNPARQTALNAGLPVTTPALTINKVCGSGLKAVHLAVQAIRSGDADVVIAGGQESM
SQSPYLMAGARAGLRLGHAQMVDSVIHDGLWDAFNDYHMGITAENLAEKYAISRAEQDSF
ALRSQQKAQAAQQAGRFAQEITPVTVPKPKGEALLVKHDEQPRDTSLEALARLRPAFRKE
GTVTAGNASSLNDGAAVVLLMSAEKAAALRLPVLARIAGYASSGVDPAIMGIGPAPATRR
CLEKAGWRLEEVDLIEANEAFAAQALAVGKELGWEAERVNVNGGAIALGHPIGASGCRIL
VSLLYEMQRRGVNKGLAMLCIGGGQGVALAVERP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacaacgtgaagtggtgatcgtggcggcaacgcgcacgccggtcggcagttttcac
ggcgcgctggcgccgttgacggcggtggaactgggcacggcggcggtgcaagggctgttg
gcgcaaagcggggtggcgccgcagcaaattgatgaagtgatcctcggccaggtgctgacc
gccggctgcgggcagaatccggcgcgccagaccgcgctgaatgccgggctgcccgttacg
acgccggcgctgactatcaacaaggtgtgcggctctggtttgaaggcggtgcatctggcg
gtgcaggcgatccgcagcggcgacgccgacgtggtaatcgccggcggccaggagagcatg
agccagtcgccttacctgatggccggcgctcgcgccggtctgcgcctcggccacgcgcag
atggtggacagcgtgatccacgatggcctgtgggacgcgttcaacgactaccacatgggc
atcactgccgagaacctggcggagaaatacgccatcagccgcgccgagcaggacagcttt
gcgctgcgctcgcagcagaaggcgcaggcggcgcagcaggccgggcgtttcgcgcaggag
atcacgccggtgacggtgccgaagccgaagggcgaagcgctgcttgttaagcacgacgag
cagccgcgcgacaccagcctggaagcactggcgcggctgcgtccggcgtttcgcaaggag
ggcacggtgaccgccggcaacgcctcgtcgctcaacgacggcgccgccgtggtgttgctg
atgagcgcggaaaaagccgccgcgctgcgtttgccggtgctggcgcgcatcgcgggttac
gcctcgtcgggcgtcgatccggcgatcatgggcatcggcccggcgccggccactcggcgc
tgcctggagaaagccggctggcggctggaggaggtcgatctgatcgaagctaacgaagcc
tttgccgcgcaggcgctggcggtgggcaaagaactgggctgggaggcggagcgggtcaac
gtcaacggcggggcgatcgcgctggggcatccgatcggcgcgtccggctgccgcattttg
gtgtcgctgctgtacgaaatgcagcgccgcggggtgaacaaggggctggcgatgctgtgc
atcggcggcgggcagggcgtggcgctggcggtagagcgcccgtaa

DBGET integrated database retrieval system