KEGG   Shewanella marisflavi: CFF01_03035Help
Entry
CFF01_03035       CDS       T05400                                 

Definition
(GenBank) inorganic phosphate transporter PiT family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
smav  Shewanella marisflavi
Brite
KEGG Orthology (KO) [BR:smav00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CFF01_03035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ASJ95641
UniProt: A0A220PSZ0
Position
complement(676449..677717)
Genome map
AA seq 422 aa AA seqDB search
MVDVLITNGPWLIAIAAAFGFLMAWGIGANDVANAMGTSVGSNAITIKQAIIIAMIFEFA
GAYLAGGEVTSTIRKGIIDSAYFVDSPELLVYGMISALLAAGIWLVVASALGWPVSTTHS
IVGAIVGFAAVGVSADSVAWSKVFGIVGSWVVTPAISGFIAFTIFQSVQKLIFNTDNPLE
NAKRYVPFYMALAGFVMSLVTIKKGLKHVGLHFTNVEAYSLAVFIAILVGLGGMVAIKRL
KMSKSADRQTQFGNVEKVFAILMVVTACCMAFAHGSNDVANAIGPLAAVVSVVNSGGEIA
SKAELVWWILPLGAFGIVLGLAIFGKRVMQTIGKNITHLTPSRGFAAELAAASTVVIASG
TGLPISTTQTLVGAVLGVGMARGIAAINIGVVRNIVVSWVVTLPAGAGLSIIFFFMIKGI
FS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggttgatgtattaatcaccaatggcccatggctgatcgccattgcggctgcatttgga
tttttaatggcgtggggtattggcgcgaacgatgtcgctaatgcaatgggaacctcagta
ggttctaacgcgatcaccattaaacaagcgatcatcatcgcaatgatcttcgaatttgcc
ggtgcttacctagcaggcggtgaagtaaccagcacgatccgtaaagggatcatcgactcg
gcttactttgtcgactcaccagagctattggtctacggtatgatctctgcgcttcttgct
gcaggtatctggctggttgtagcctcagcactgggctggccagtatctaccactcactct
atcgttggcgcgatcgttggtttcgccgccgttggtgtaagtgctgactctgttgcttgg
agcaaggtatttgggatcgtcggttcttgggtggtcaccccggctatctcaggctttatc
gcctttaccatcttccaaagcgtacagaagctgatcttcaacactgacaatccgctggaa
aacgctaagcgttatgtgcctttctatatggcactggctggttttgtgatgtcactggtg
accatcaagaagggtcttaagcacgttggtctgcactttaccaatgtggaagcctactca
ctggctgtctttattgccatcctggttggtcttggcggcatggtagccatcaagcgtctg
aagatgagcaagagcgccgatcgtcaaacccagtttggcaacgtggagaaggtgttcgct
atcctgatggttgtgaccgcatgttgtatggcattcgcccacggttctaacgatgtcgcc
aacgcaattggcccgctggctgcagtggtatccgttgtaaatagcggtggtgagatcgcc
agcaaagctgaattggtatggtggatcttacctttgggtgcctttggtatcgtcctgggt
ctggctatctttggtaagcgcgtaatgcaaaccataggtaaaaacattacccacctgacc
ccaagccgcggctttgccgccgagctggctgccgcatcaaccgtggttatcgcctcgggt
accggtctgcctatctcaaccacacagacactagtcggtgctgtactgggtgtaggtatg
gctcgtggtatcgctgcgatcaatatcggcgtagtgcgtaacatcgtggtctcttgggtc
gtcaccctacctgcgggcgcgggtctgtcgatcatcttcttcttcatgattaaagggatc
tttagctaa

DBGET integrated database retrieval system