KEGG   Sphingopyxis macrogoltabida 203: LH19_03085Help
Entry
LH19_03085        CDS       T04627                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smaz  Sphingopyxis macrogoltabida 203
Pathway
smaz00071  Fatty acid degradation
smaz00072  Synthesis and degradation of ketone bodies
smaz00280  Valine, leucine and isoleucine degradation
smaz00310  Lysine degradation
smaz00362  Benzoate degradation
smaz00380  Tryptophan metabolism
smaz00620  Pyruvate metabolism
smaz00630  Glyoxylate and dicarboxylate metabolism
smaz00640  Propanoate metabolism
smaz00650  Butanoate metabolism
smaz00900  Terpenoid backbone biosynthesis
smaz01100  Metabolic pathways
smaz01110  Biosynthesis of secondary metabolites
smaz01120  Microbial metabolism in diverse environments
smaz01130  Biosynthesis of antibiotics
smaz01200  Carbon metabolism
smaz01212  Fatty acid metabolism
smaz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LH19_03085
   00630 Glyoxylate and dicarboxylate metabolism
    LH19_03085
   00640 Propanoate metabolism
    LH19_03085
   00650 Butanoate metabolism
    LH19_03085
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LH19_03085
   00072 Synthesis and degradation of ketone bodies
    LH19_03085
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LH19_03085
   00310 Lysine degradation
    LH19_03085
   00380 Tryptophan metabolism
    LH19_03085
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LH19_03085
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LH19_03085
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LH19_03085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smaz04147]
    LH19_03085
Enzymes [BR:smaz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LH19_03085
Exosome [BR:smaz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LH19_03085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ALJ11844
UniProt: A0A0P0DDJ7
Position
616651..618141
Genome map
AA seq 496 aa AA seqDB search
MSDENIPIIVGVGQINDRPENPVDGHSPVGLMAEALRIAEMDAGGALLADADYLGIVQQI
SFRDIRDARDPLAQELGIAPATMVQSEGPNGDSPVMLLNEAANRIGAGESRIALVCGAEA
LRTAAARAAAQESGRRIDATREAAQRREPSYAQQYGLVAPVDVYPLYENALRASLGQSFA
EAQAESGMIWSLFSEVAAANPNAWLRKPVSADEVIAPSESNRPIAFPYNKLMVANASVNQ
GAAFIVTSVAEARRRGIAEDRWIYVGNGAAAHEPNSPLQRDRYDHSASMEVSIRRTLALN
DVDPSGLDIVELYSCFPCIPKLARRIIDWPAERPATVFGGLTFGGGPIGNYMGHAIASMT
DRLRVDGGTGLLFANGGYATHNHSIVISSEPITAASFPRSYDYQEEADAMRDAIPALARD
YLGDATIESYTILYRRDGLPKAGVVVARTPAGERTLAHVPPGDEAVLRRLADAEADPVGA
TGRIVEGAALREWRFA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgagaatatccccatcatcgtcggcgtcggccagatcaacgatcgaccggaa
aaccccgtggacggacacagcccggtcggcttgatggccgaggccctccggatcgccgaa
atggatgccggaggcgcgttgcttgccgacgccgattatctcggcatcgtccagcagata
tcgttccgcgacatccgcgacgcgcgcgacccgctggcccaggaactcggcatcgcaccc
gcgacgatggtgcaaagcgaagggccgaacggcgacagtccggtcatgctgctcaacgag
gcggcgaaccggatcggggccggcgaatcccggatcgcgctggtctgcggtgccgaggcg
ctgcgaaccgcggcggcgagagcggcggcacaggaatccggtcgccgcatcgacgcgacg
cgcgaagcagcgcagcggcgcgagccgagctatgcccagcaatatgggctggtggcgccg
gtcgatgtgtatccgctttacgaaaatgcgctccgtgcatcgctcgggcaaagtttcgcc
gaggcgcaggccgagagcgggatgatctggtcgcttttttcggaggtcgcggccgccaat
ccgaacgcctggcttcgcaagccggtcagtgccgacgaggtgatcgcaccgtcggaaagc
aaccggccgatcgccttcccctataacaagctgatggtcgccaacgcttcggtcaaccag
ggcgccgccttcatcgtgacgagtgttgcggaggcgcgccggcgcggtatcgcggaggat
cgctggatctatgtcggcaatggcgccgccgctcacgaaccgaacagcccgctgcagcgc
gatcgttacgaccatagtgcgagcatggaggtttcgatccgccggaccctggcgctgaat
gatgtcgacccgtcggggctagacatcgtcgaattgtacagctgttttccctgcatcccg
aagctcgcccgccggatcatcgattggcccgccgaacggccagccacggtctttggcggg
ctgaccttcggcggcgggccgatcggcaactatatgggccacgccattgcgagcatgacc
gatcggttgcgggtggatggcggcacggggctgctctttgcaaatggcggttacgcgacg
cacaatcacagcatcgtgatcagcagcgagccgatcaccgcggcctcctttccccgcagc
tacgactatcaggaggaggctgacgcgatgcgcgatgcaattccggcgctggcgcgcgac
tatctgggcgacgcgaccatcgaaagctacacgatcctctatcggcgcgacggattgcca
aaggcgggcgtggttgtcgccaggaccccggcgggcgagcggacgctcgcccatgtccca
cccggcgatgaagccgtgctgcgccggctggccgatgcggaggcggatcctgtcggcgcc
accggccggatcgtagagggcgcggcgcttcgcgaatggcgctttgcgtga

DBGET integrated database retrieval system