KEGG   Sphingopyxis macrogoltabida 203: LH19_12445Help
Entry
LH19_12445        CDS       T04627                                 

Definition
(GenBank) aconitate hydratase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
smaz  Sphingopyxis macrogoltabida 203
Pathway
smaz00640  Propanoate metabolism
smaz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LH19_12445
Enzymes [BR:smaz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     LH19_12445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: ALJ13681
UniProt: A0A0P0D3C4
Position
2441740..2444361
Genome map
AA seq 873 aa AA seqDB search
MNQPYRKPLPGTGLDYFDTRAAIDAIRPGAYDGLPYVSRVLAEQLVRRCDPALLPAALKQ
IVDRKRDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEQGGDPARVNPVVPTQLIVDH
SLAVEYAGFDTDAFAKNRAVEDRRNEDRFHFIEWTKSAFENVDVIPAGNGIMHQINLEKM
SPVVQVRDGVAFPDTCVGTDSHTPHIDALGVIAIGVGGLEAETVMLGRASMMRLPDIVGV
RLTGAPAPGITATDIVLALTEYLREARVVGAWLEFFGEGADRLTIGDRATISNMCPEYGA
TAAMFHIDRQTIDYLLLTGRDPGQVRLVETYAKTTGLWADALKTASYERLLEFDLSGVVR
NMAGPSNPHRRLPTTALEERGIAVGLDEARAEEREGLLPDGAVIIAAITSCTNTSNPRNV
VAAGLVAKKANDLGLTRKPWVKSSFAPGSKVARLYLEEAGLLAELETLGFGIVAFACTTC
NGMSGALDPAIEREIVARDLYATAILSGNRNFDGRIHPQAKQAFLASPPLVVAYAIAGTI
RFDIENDVLGTVNGKDIRLADLWPTDAEIDAIVAAAVKPEQFRAVYDPMFARRGTAVKND
PLYNWRPQSTYIRRPPYWDTEGVGALAASPRTLKGMRPLAILPDNITTDHLSPSNAILAS
SAAGEYLAKMGVPEEDFNSYATHRGDHLTAMRATFANPQLVNEMAVVDGAVKKGSLARVE
PDGKVMRMWEAIETYLERRQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIH
RTNLIGMGVLPLEFKPGTTRLRLNLDGTETYDIAGTPRPRADLTMVIHRRNGMTLEVPVT
CRLDTAEEASIYEAGGVLQRFAQDFLATEMAVA
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagccatatcgcaagccgctaccgggaaccggtctcgactatttcgatacccgc
gccgcgatcgacgcgatccgtcccggcgcctatgacggcctgccctatgtgtcgcgggtg
ctcgccgaacagctcgtccgccgctgcgaccccgcgctcctccccgccgcgctgaaacag
atcgtcgaccgcaagcgcgacctcgatttcccctggtatccggcgcgtgtcgtctgtcac
gacattctcggccagacggcgctcgtcgatcttgccgggctgcgcgacgccatcgccgaa
caggggggtgaccccgccagggtcaacccggtggtgccgacccagctcatcgtcgatcac
agcctcgcggtcgaatatgcgggtttcgacaccgacgcctttgcgaaaaaccgcgcggtc
gaggaccgccgcaacgaagaccgcttccacttcatcgaatggacgaaaagcgccttcgaa
aatgtcgatgtcatcccggccggcaacggcatcatgcaccagatcaacctcgagaagatg
tcgccggtcgttcaggtccgggacggcgtcgccttccccgacacctgcgtcggtaccgac
agccacacgccgcacatcgacgcgctcggggtgatcgcgatcggcgtcggcgggctcgag
gccgaaacggtgatgctcggtcgcgcctcgatgatgcggctgcccgatatcgtcggggtc
cgcctcaccggcgcccccgcgcctgggatcaccgcgaccgacatcgtgctcgcgctcacc
gaatatctgcgcgaggcgcgcgtcgtcggcgcctggctcgaatttttcggcgagggcgcc
gaccggctgacgatcggcgaccgcgcaacgatctcgaacatgtgccccgaatatggcgcc
accgctgcgatgttccatatcgaccggcagacgatcgattatctgctcctgaccggccgc
gatcccgggcaggtgcggctggtcgaaacctatgcgaagacgaccggcctgtgggccgac
gcgctgaagacagcaagctacgagcgcctgctcgaattcgacctgtcgggcgtcgtccgc
aacatggcgggcccgtcgaacccgcaccgccgcctgccaaccaccgcactcgaagaacgc
ggcattgcggtcgggctcgacgaagcacgcgccgaggagcgcgagggactgctccccgac
ggcgcggtgatcatcgccgcgatcacgagctgcaccaacacctcgaacccccgcaatgtc
gtcgccgcgggcctcgtcgcgaagaaggcgaatgacctcggcctcacccgcaagccatgg
gtcaagagcagcttcgcgccgggctcgaaagtcgcgcgcctctatctcgaagaggcgggg
ctgctcgccgaactcgaaacgctcggtttcggcatcgtcgcctttgcctgcacgacgtgc
aacggcatgtcgggcgccctcgatcccgctatcgagcgcgagatcgtcgcgcgcgatctc
tatgcgaccgctatcctctccgggaaccgcaacttcgacggccgcatccacccgcaggca
aaacaggcgttcctcgcctcgccgccgctcgtcgttgcctatgcgatcgccgggacgatc
cgcttcgacatcgaaaacgatgtgctcgggacggtgaatggcaaggatatccgccttgcc
gatctgtggccaaccgacgccgaaatcgacgcgatcgtcgccgctgcggtcaagcccgaa
caattccgcgccgtctatgacccgatgttcgcgcgccgcggcaccgcggtgaagaacgac
ccgctctacaactggcgcccgcaatcgacctatatccgccgcccgccctattgggacacc
gaaggcgtcggcgcactcgccgccagcccgcgaacgctgaagggcatgcgcccgctcgcg
atccttcccgacaacatcaccaccgaccatctgtcgccgtcgaacgcgatcctcgccagc
tcggcggcgggcgaatatctcgcgaaaatgggcgtccccgaggaggacttcaacagctac
gcgacgcaccgcggcgaccatctgaccgcgatgcgcgccaccttcgccaacccgcagctc
gtcaacgaaatggccgtggtcgacggcgcggtgaaaaagggatcgctcgcccgcgtcgag
cccgacggcaaggtcatgcggatgtgggaggcaatcgagacctatctcgaacgccgccag
ccgctgatcatcatcgccggcgccgattacgggcagggctcgtcgcgcgactgggcggca
aagggcgtccggctcgcgggcgtcgaggccatcgtcgccgaggggttcgagcgcatccac
cgcaccaacctcatcggcatgggcgtgctgccgctcgagttcaagccgggaacgacgcgg
ctgcggctcaatctcgacggcaccgaaacctatgacatcgcgggaacgccgcgcccgcgc
gccgacctgacgatggtcattcaccgccgcaacggcatgacgctcgaagtcccggtaacc
tgccgcctcgataccgccgaggaagcatcgatctacgaagccggcggcgtcctccagcgc
ttcgcacaggatttcctcgccaccgaaatggcagtcgcatga

DBGET integrated database retrieval system