KEGG   Sphingopyxis macrogoltabida 203: LH19_13850Help
Entry
LH19_13850        CDS       T04627                                 

Definition
(GenBank) hypothetical protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
smaz  Sphingopyxis macrogoltabida 203
Pathway
smaz00260  Glycine, serine and threonine metabolism
smaz00630  Glyoxylate and dicarboxylate metabolism
smaz00670  One carbon pool by folate
smaz01100  Metabolic pathways
smaz01110  Biosynthesis of secondary metabolites
smaz01130  Biosynthesis of antibiotics
smaz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LH19_13850
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LH19_13850
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LH19_13850
Enzymes [BR:smaz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     LH19_13850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: ALJ13954
UniProt: A0A0P0DZ56
Position
complement(2744448..2745641)
Genome map
AA seq 397 aa AA seqDB search
MTQTAAEGCAFVMQPRETDMTENEPTGEEFAVPTATLPLDAWHRDRGARMVEFAGYWMPI
QYEGIMAEHMWTRENAGLFDVSHMGQISLSGAGVAEALEALVPGDISALKPGRMRYSLLL
GEDGGILDDLMVTNEGDQLGIVVNGAVKWDDIGYLRENLPDDITLNHNEDYGLLALQGPK
AATALARLVPEAAGLVFMQAARAIWNGHAIGLSRSGYTGEDGYEISLPNEALEAFADALC
AMDEVKPIGLGARDSLRLEAGLPLYGHDLDPTTDPIEGDLAFAISKRRREEGGFPGAARI
LGHLADGSPRKRVGLLVDGKMPVREGAKLFDGNTEIGIVTSGGFAPSVGAPIAMGYVPRD
HAAPGTAIAAEVRGKRVHCTVAAMPFVPHNYVRKQGG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaaccgcggcagagggctgcgcgttcgtcatgcaaccgcgggagactgacatg
accgaaaatgaaccgacgggcgaagagtttgcggtgccgaccgcgaccctgccgctcgac
gcctggcaccgcgaccgcggcgcgcggatggtagaattcgccggctactggatgccgatc
cagtatgaaggcatcatggccgaacatatgtggacgcgcgagaatgcgggcctgttcgac
gtcagccatatggggcagatcagcctgtcgggtgccggcgttgccgaagcactcgaagcg
ctcgtccctggcgatatctcggcgctgaaacccggccgcatgcgctattcgttgctgctc
ggcgaggacggcggcattctcgacgacctgatggtgaccaatgaaggcgaccagcttggc
atcgtcgtcaacggtgcggtcaaatgggacgatatcggctatctgcgcgaaaatcttccc
gacgacatcacgctcaatcacaatgaggattacggcctgctggcgttgcagggaccgaag
gcggcgacggcgctcgcgcggctggttcccgaggcggccggccttgtcttcatgcaggcg
gcgcgcgcgatatggaacggccatgcgatcggcctcagccgttcgggctataccggtgag
gacggttacgagatttcgctgccgaacgaggcactcgaagcttttgccgacgcgctctgc
gcgatggacgaggtgaagccgatcggcctcggcgcgcgcgacagcctgcgcctcgaagcc
ggcctgccgctctatggccacgacctcgacccgacgaccgatcccatcgaaggcgatctg
gcgttcgcgatcagcaagcgccgccgcgaagagggcggtttcccgggcgcggcgcgcatc
ctcggccacctggccgacggcagcccgcgcaagcgcgtcggcctgctcgtcgatggtaaa
atgccggtgcgcgagggcgcgaagctgttcgacggcaacaccgaaatcggcatcgtgact
tcgggcggctttgcgccgagcgtcggtgcgccgatcgccatgggctatgtcccccgcgac
cacgcggcgcccggcacggcgatcgccgccgaggtgcgcggcaagcgggtgcattgcacc
gtcgcggcgatgcccttcgttccccataattatgtccgcaaacagggaggctga

DBGET integrated database retrieval system