KEGG   Sphingopyxis macrogoltabida 203: LH19_18315Help
Entry
LH19_18315        CDS       T04627                                 

Definition
(GenBank) nuclease PIN
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
smaz  Sphingopyxis macrogoltabida 203
Brite
KEGG Orthology (KO) [BR:smaz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LH19_18315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ALJ14828
UniProt: A0A0P0DF24
Position
3674302..3675930
Genome map
AA seq 542 aa AA seqDB search
MNATTAAAPLDSGEFERPDLDKGLGAAGNLGFVAAIIVALGYVAYSVYADAAAAGVHATA
FLPFALLFLALVIALGFEFVNGFHDTANAVATVIYTNSMPANYAVVWSGFFNFLGVLLST
GAVAFGIVSLLPVELILQVGSNAGFAMVFALLIAAIVWNLATWYFGIPSSSSHTLIGSII
GVGVANAMLHGKSGTAGVDWGKATEIGYALLLSPLLGFTVAALLFLAMKVLIRNKTLYEA
PKGNTPPPWWIRALLIFTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTAYALNRAVPEKY
VQEFVVNSNAAEQVLAAHGGGPAPTLASPQDARRAVTAYIADKKLSPETLPALGALVDQV
ETQVSGYGSLAKVPAAATENMRNDMYLASEAIKRLGKEKRLTFTDAETEALTTYKGSLDS
ATRFIPTWVKIAVAFALGLGTMIGWKRIVVTVGEKIGKSHLTYAQGASAELVAMGTIGAA
DMLGLPVSTTHVLSSGVAGTMAANRSGLQMSTIRNLLMAWVLTLPVSIVLAGVLYAILSA
IF
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccacgaccgccgccgccccactcgatagcggcgaattcgaacgcccggatctc
gacaagggattgggcgcggccggcaacctcggctttgtcgccgcgattatcgttgcgctc
ggatatgtcgcctacagcgtttatgccgacgccgcggccgcgggggtccatgcgaccgcc
ttcctgcctttcgcgctgcttttcctcgcgctggtcatcgcgctcggcttcgaattcgta
aacggcttccacgacaccgccaacgcggtggcgaccgtaatttacaccaattcgatgccc
gccaactatgccgtcgtctggtcgggcttcttcaatttcctcggcgtgctgctctcgacc
ggggcggtggccttcggcatcgtctcgctgcttcccgtcgagctgatcctgcaggtcggg
tcgaatgccggcttcgcgatggttttcgcgctgctcatcgcggcgatcgtctggaacctc
gcaacctggtatttcggcattccctcgtcgagctcgcacacgctgatcggctcgatcatc
ggcgtcggcgtcgccaacgccatgctccacggcaagagcggcaccgccggggtcgactgg
ggcaaggcgaccgagatcggttacgcgctgcttctctcgccgttgctcggcttcaccgtc
gcggcgctgctcttcctcgcgatgaaggtgctgatccgcaacaagacgctctatgaagcg
ccgaagggcaacaccccgccgccgtggtggattcgcgccctcctcatcttcacctgcacc
ggggtcagcttcgcgcacgggtcgaacgacgggcaaaagggcatgggcctgatcatgctc
atcctgatcggcaccgtcccgacggcctatgcgctcaaccgcgcggttcccgagaaatat
gtgcaggaattcgtcgtcaactcgaacgcggccgaacaggtgctcgcggcgcacggcggc
ggcccggcccccacgctcgcgtcaccgcaggatgcacgccgcgcggtcacggcctatatc
gccgacaagaaactgtcgcccgaaaccctccccgcgctcggcgcgctggtcgatcaggtc
gaaacgcaggtcagcggctatggctcgctcgccaaggtgcccgccgccgcgaccgagaat
atgcgcaacgacatgtatctcgcatccgaggcgatcaagcggctgggcaaggaaaagagg
ctgaccttcaccgacgccgagaccgaagcgctgacgacatataagggctcgctcgacagt
gcgacgcgcttcatcccgacctgggtcaagatcgccgtcgccttcgcgctcgggctcggc
acgatgatcggctggaaacgcatcgtcgtcaccgtcggcgaaaagatcggcaagtcgcac
ctcacctatgcgcagggcgcctcggccgagctcgtcgcgatgggaacgatcggcgccgcc
gacatgctcggtctgccggtctcgaccacgcacgtcctctcgtcgggcgtcgccgggacg
atggcggcgaaccgctcgggcctccagatgtcgacgatccgaaacctgctgatggcatgg
gtgctgacgctgccggtatcgatcgtgctcgcgggagtgctgtacgcgatcctcagcgct
attttctaa

DBGET integrated database retrieval system