KEGG   Sphingopyxis macrogoltabida 203: LH19_24585Help
Entry
LH19_24585        CDS       T04627                                 

Definition
(GenBank) hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
smaz  Sphingopyxis macrogoltabida 203
Pathway
smaz00361  Chlorocyclohexane and chlorobenzene degradation
smaz00625  Chloroalkane and chloroalkene degradation
smaz01100  Metabolic pathways
smaz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smaz00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LH19_24585
   00361 Chlorocyclohexane and chlorobenzene degradation
    LH19_24585
Enzymes [BR:smaz01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     LH19_24585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ALJ16068
UniProt: A0A0P0E3Z6
Position
complement(4979480..4980088)
Genome map
AA seq 202 aa AA seqDB search
MIRRSVIFDVGRVLFDWDLRHLFAKLIADRDELEWFVTHVVTPEWHFQHDAGRPLAEMLP
ELKAEFPGHGALIDAYATRFNETIPGPVPGSLELVERLDAAGVPLFAITNFGHEFWEAFR
PTQPIFDRFRDIIVSGTEKLLKPDPAIYRLAIDRFGIDPAGALFIDDVAANVAGAESVGI
AGHRFRGAADLERDLGARGYLP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgattcgccgatctgtgatcttcgacgtcggccgcgtcctcttcgactgggacctgcgc
catctgttcgccaagctgatcgccgaccgcgacgaactcgaatggttcgtaacgcatgtc
gtgacgcccgaatggcatttccagcacgacgcggggcggccgctcgccgagatgctgccc
gagctgaaggcagaatttccagggcatggagcgctgatcgacgcctatgcgacgcgtttc
aacgagacgattccggggccggtgcccggcagcctcgaactggtcgaacggctcgacgcg
gcgggcgtgcccttgttcgcgatcaccaatttcgggcacgagttctgggaagctttccgc
ccgacccagccgatcttcgaccgcttccgcgacatcatcgtttcgggcaccgaaaagctg
ctgaagcccgatccggcgatctaccgccttgcgatcgatcgattcggcatcgaccccgcg
ggggcgctgttcatcgacgatgtcgcggcgaatgtcgcgggcgccgaatcggtcgggatc
gcggggcatcgcttccgcggcgcggcagatttggaacgtgacctcggcgcgcgcggctat
ttgccctga

DBGET integrated database retrieval system