KEGG   Streptococcus mitis: smi_0233Help
Entry
smi_0233          CDS       T01173                                 

Gene name
rluA1
Definition
(RefSeq) 23S_rRNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
smb  Streptococcus mitis
Brite
KEGG Orthology (KO) [BR:smb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:smb03009]
    smi_0233 (rluA1)
Enzymes [BR:smb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     smi_0233 (rluA1)
Ribosome biogenesis [BR:smb03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    smi_0233 (rluA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-GeneID: 8798945
NCBI-ProteinID: YP_003445386
UniProt: D3H6M6
Position
complement(230664..231539)
Genome map
AA seq 291 aa AA seqDB search
MKFTFTLPASLPQMTVKQLLEEQLLIPRKIRHFLRIKKHILINQREIHWNETVNPGDVCQ
LTFDEEDYPEKEIPWGNPNLIQEVYQDQHLIIVNKPEGMKTHGNQPNEIALLNHVSAYVG
QTCYVVHRLDMETSGLILFAKNPFILPILNRLLEKKKISREYWALVDGNINSKELVFRDK
IGRDRHDRRKRVVDTKNGQSAETHISRLKQFPNKTSLVRCKLKTGRTHQIRVHLSHHNFP
ILGDPLYNNNSTTSRLMLHAFRLSFTHPLTLEKLNFTALSNTFETELKKNG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcacatttacattacccgcctctttacctcaaatgacggtgaagcaactacta
gaagagcaactcctcattcctagaaaaatccgtcattttttgagaatcaagaaacacatt
ttgattaatcagcgagaaattcactggaacgagacggtaaatcctggagatgtttgccaa
ttgacttttgacgaggaagattatcctgaaaaagaaattccttggggcaacccaaacctc
attcaggaagtttatcaagaccaacacttgattattgtaaacaaacctgaggggatgaaa
acacacggtaaccaaccaaacgaaatcgcccttcttaaccatgtcagtgcctatgttggc
caaacctgctatgtcgttcatcgtctggacatggaaaccagtggcttgattctctttgcc
aaaaatccttttatcctacctattctcaaccgcttattggagaaaaaaaagatttctagg
gaatattgggcacttgttgatggaaatatcaacagcaaagagcttgttttcagagataaa
atcggacgtgatcgtcatgaccgcagaaaacgagtagttgatacaaaaaatggacaatct
gctgaaacgcatataagcagattaaagcaatttccaaacaaaacttccttggttcgttgc
aaactaaagacaggtcgaacccatcaaatccgtgtgcacctttcgcatcataacttcccg
atcctgggcgaccctctctataacaacaattcaacgacaagtcggcttatgcttcatgcc
ttccgactttcctttacccatccacttacattagaaaaattaaacttcactgccctctcg
aatacttttgaaacagaattaaaaaagaatggatga

DBGET integrated database retrieval system