KEGG   Streptococcus mitis: smi_0275Help
Entry
smi_0275          CDS       T01173                                 

Gene name
adhP
Definition
(RefSeq) alcohol dehydrogenase, propanol-preferring, COG1064
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
smb  Streptococcus mitis
Pathway
smb00010  Glycolysis / Gluconeogenesis
smb00625  Chloroalkane and chloroalkene degradation
smb00626  Naphthalene degradation
smb01100  Metabolic pathways
smb01110  Biosynthesis of secondary metabolites
smb01120  Microbial metabolism in diverse environments
smb01130  Biosynthesis of antibiotics
smb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    smi_0275 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    smi_0275 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    smi_0275 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    smi_0275 (adhP)
   00626 Naphthalene degradation
    smi_0275 (adhP)
Enzymes [BR:smb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     smi_0275 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 Sacchrp_dh_NADP Methyltransf_31
Motif
Other DBs
NCBI-GeneID: 8799060
NCBI-ProteinID: YP_003445415
UniProt: D3H6Q5
Position
complement(270275..271294)
Genome map
AA seq 339 aa AA seqDB search
MKAVVVNPESTGVAVEEKVLRPLETGEALVEIEYCGVCHTDLHVAHGDFGQVPGRVLGHE
GVGIVKEIAPDVKSLKIGDRVSVAWFFEGCGTCEYCTTGRETLCRTVKNAGYSVDGGMAE
QCIVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAKVEPGQWVVLYGAGGLGNLAVQ
YAKKVFNAHVIAVDINNDKLALAKEVGADIVINGLEVEDVPGLIKEKTDGGAHSAVVTAV
SKVAFNQAVDSVRAGGRVVAVGLPSEMMELSIVKTVLDGIQVIGSLVGTRKDLEEAFQFG
AEGLVVPVVQKRPVEDAVAIFDEMEKGQIQGRMVLDFTH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttgttgtaaatccagaaagcactggtgttgctgttgaagaaaaagtactc
cgcccacttgaaactggggaagcacttgtagaaattgaatactgtggcgtttgccacacc
gacctccacgttgctcatggtgactttggtcaagtaccaggacgtgttcttggccacgaa
ggtgttggtatcgttaaagaaattgccccagatgtgaaaagccttaaaatcggtgaccgc
gtcagcgttgcttggttcttcgaaggatgtggtacttgcgaatactgtacaactggccga
gaaaccctttgccgtacagtaaaaaatgctggctactcagtagacggtggtatggctgaa
caatgtatcgtaactgcagactatgctgttaaagttcctgacggacttgatccagcccaa
gcttcttctattacatgtgctggggtaacaacctataaagcgattaaagaagccaaagtc
gaaccaggccaatgggttgttctttacggtgcaggtggacttggtaacctcgctgttcaa
tacgctaaaaaagtattcaatgctcatgtcatcgcagttgatatcaacaacgacaaactt
gcccttgcaaaagaagtaggtgcggacattgttattaacggcctcgaagttgaagatgta
cctggactcatcaaggaaaaaactgatggtggagctcattcagccgtcgtaacagctgta
tctaaagttgccttcaaccaggctgttgactccgttcgtgctggtggtcgcgtcgtcgct
gttggccttccttctgaaatgatggaactcagcatcgtgaaaaccgttctagatggaatc
caagtcatcggttctcttgttggaactcgtaaagacttggaagaagccttccaattcggc
gcagaaggtttggtagttccagttgtccaaaaacgtccagtcgaagatgccgtagccatt
ttcgacgaaatggaaaaaggtcaaattcaaggacgtatggtactcgacttcacccactaa

DBGET integrated database retrieval system