KEGG   Streptococcus mutans NN2025 (serotype c): SmuNN2025_0428Help
Entry
SmuNN2025_0428    CDS       T01185                                 

Gene name
dltA
Definition
(GenBank) putative D-alanine-D-alanyl carrier protein ligase
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
smc  Streptococcus mutans NN2025 (serotype c)
Pathway
smc00473  D-Alanine metabolism
smc01100  Metabolic pathways
smc01503  Cationic antimicrobial peptide (CAMP) resistance
smc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SmuNN2025_0428 (dltA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SmuNN2025_0428 (dltA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SmuNN2025_0428 (dltA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:smc01504]
    SmuNN2025_0428 (dltA)
Enzymes [BR:smc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     SmuNN2025_0428 (dltA)
Antimicrobial resistance genes [BR:smc01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    SmuNN2025_0428 (dltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C FTH
Motif
Other DBs
NCBI-ProteinID: BAH87454
Position
460462..462012
Genome map
AA seq 516 aa AA seqDB search
MANKKIKDMIATIENFAQEQAEFPVYNILGEIHTYGELKADSDSLAAHLDQLDLTAKSPV
VVFGGQEYAMLASFVALTKSGHAYIPIDHHSALERIEAILEVAEPSLVIAVDDFPIDNLQ
VPVIQYSQLEEIFKQKLSYQINHAVKGDDTYYIIFTSGTTGKPKGVQISHDNLLSFTNWM
INAEAFAIPHRPQMLAQPPYSFDLSVMYWAPTLALGGTLFALPKEITADFKQLFTTINQL
PIGVWTSTPSFVDMAMLSDDFNAQQLPHLTHFYFDGEELTVKTAKKLRQRFPQARIVNAY
GPTEATVALSALAVTDKMLETCKRLPIGYTKPDSPTFIIDESGHKLANGQQGEIIVSGPA
VSKGYLNNPERTAAAFFEFEGLPAYHTGDLGSMTDEGLLLYGGRMDFQIKFNGYRIELEE
VSQNLNKSQYIASAVAVPRYNKDHKVQNLLAYVVLKDGVEEQFERALDITKAIKADLQDV
MMDYMMPSKFLYRKDLPLTPNGKIDIKGLMSEVNKK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggctaataaaaaaataaaagatatgattgcaacaattgaaaattttgctcaagaacag
gcagaatttccggtttataatattttaggagaaatccatacctatggagaattaaaagct
gattctgattcgcttgcggctcatcttgatcagttagatttaacagcaaaatcaccagta
gttgtctttggaggacaggaatatgccatgctggctagttttgttgctctgacaaaatca
gggcatgcctatattcctattgatcatcattcagccttagaacgtattgaggctatttta
gaggtagcagagccaagtttagttattgctgttgatgatttcccaattgacaatcttcaa
gtcccagtaattcagtatagtcaattagaagaaatttttaaacaaaagctatcttatcaa
atcaatcatgcggttaagggagatgatacctactatatcatctttacttcagggacaact
ggtaaacctaaaggagtacagatttcacatgacaatctgcttagttttactaattggatg
attaatgcagaagcttttgcaatacctcataggccgcaaatgctggcacaaccgccttac
tcttttgatttgtcagtgatgtattgggcgccaacattggctttaggtggaacccttttt
gctcttcctaaagaaataactgcagatttcaaacaattatttacaactattaaccaatta
cccattggtgtgtggacatcaacaccttcctttgttgatatggctatgctgtcagatgac
tttaatgcacagcaattgcctcatttaactcatttctattttgacggagaagagttgacg
gttaagacggctaaaaaattgcgtcagcgttttccgcaagcaagaattgtcaacgcttat
gggccaacagaagcaactgttgctttatcagctttggctgtcactgataaaatgcttgaa
acatgcaaacgtctgccaattggctatacaaaaccagattcgccaacctttattattgat
gagtcaggtcataaactggcaaatggtcagcaaggagagattattgtttccggtccggca
gtctctaaggggtatctcaataatcctgaacgaacagcagcagctttctttgaatttgaa
ggtttgccagcttatcatactggtgatttgggaagtatgacagatgaaggtctcttgctc
tatggcggtcgtatggattttcagattaaattcaatggctatcgtattgagttggaagaa
gtctctcaaaatcttaacaaatcgcaatatatcgcatctgctgtagctgttccccgttat
aataaagaccataaggtgcaaaatcttttagcttatgttgtcttaaaagatggtgtagaa
gagcaatttgagagagcacttgacattaccaaggctattaaggctgatttgcaagatgtt
atgatggattacatgatgccttctaagtttttgtaccgtaaagatttacctttaacacct
aatggtaaaattgatattaaaggtttgatgagtgaggtaaacaaaaaatga

DBGET integrated database retrieval system