KEGG   Streptococcus mutans NN2025 (serotype c): SmuNN2025_0686Help
Entry
SmuNN2025_0686    CDS       T01185                                 

Definition
(GenBank) putative phosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
smc  Streptococcus mutans NN2025 (serotype c)
Pathway
smc00627  Aminobenzoate degradation
smc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SmuNN2025_0686
Enzymes [BR:smc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     SmuNN2025_0686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: BAH87712
Structure
PDB: 

Position
727924..728697
Genome map
AA seq 257 aa AA seqDB search
MTYKGYLIDLDGTIYKGKDRIPAGEDFVKRLQERQLPYILVTNNTTRTPEMVQEMLATSF
NIKTPLETIYTATLATIDYMNDMKRGKTAYVIGETGLKKAVAEAGYREDSENPAYVVVGL
DTNLTYEKLTLATLAIQKGAVFIGTNPDLNIPTERGLLPGAGAILFLLEKATRVKPIIIG
KPEAVIMNKALDRLGVKRHEAIMVGDNYLTDITAGIKNDIATLLVTTGFTKPEEVPALPI
QPDFVLSSLAEWDFDER
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacatacaagggttaccttattgaccttgatgggaccatctataaaggaaaagacaga
attcctgctggagaagattttgttaaacgattgcaggaaagacagcttccctatatttta
gtgactaataatacaacacgtacgcccgaaatggttcaagaaatgctagcaacctctttt
aatatcaaaacgccacttgaaactatttacacagcgaccttagcgactattgattatatg
aacgatatgaaacgtgggaaaacagcttatgtcattggtgaaacaggacttaaaaaggct
gttgctgaagcggggtatcgtgaagatagtgagaatcctgcttatgtagtggttggttta
gatacgaatttgacttatgaaaagctaactctggcgactttggccattcaaaaaggggct
gtttttattggaacaaatcctgatctcaatattccaacagagcgcggcttattgccggga
gcgggagctattttatttcttttggaaaaagcaacacgtgttaagcctattattattggt
aagcctgaagctgttatcatgaataaagctttagatcgtctgggcgtcaaacgccatgaa
gcgataatggttggcgataattatctgacagatattactgctggcattaaaaatgatatt
gcaacgcttttggtgacgacaggtttcaccaaaccagaagaagtacctgctttgccaatt
cagcctgattttgttttatccagtcttgcggagtgggatttcgatgaaagataa

DBGET integrated database retrieval system