KEGG   Streptococcus mutans NN2025 (serotype c): SmuNN2025_1382Help
Entry
SmuNN2025_1382    CDS       T01185                                 

Gene name
pmgY
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
smc  Streptococcus mutans NN2025 (serotype c)
Pathway
smc00010  Glycolysis / Gluconeogenesis
smc00260  Glycine, serine and threonine metabolism
smc00680  Methane metabolism
smc01100  Metabolic pathways
smc01110  Biosynthesis of secondary metabolites
smc01120  Microbial metabolism in diverse environments
smc01130  Biosynthesis of antibiotics
smc01200  Carbon metabolism
smc01230  Biosynthesis of amino acids
Module
smc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
smc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SmuNN2025_1382 (pmgY)
  Energy metabolism
   00680 Methane metabolism
    SmuNN2025_1382 (pmgY)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SmuNN2025_1382 (pmgY)
Enzymes [BR:smc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SmuNN2025_1382 (pmgY)
Membrane trafficking [BR:smc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SmuNN2025_1382 (pmgY)
Exosome [BR:smc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SmuNN2025_1382 (pmgY)
  Exosomal proteins of melanoma cells
   SmuNN2025_1382 (pmgY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAH88408
Position
complement(1465396..1466088)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEEGTQQAIDAGKLIKEADIKFDLAFTSVLTR
AIKTTNLALEYSDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEKFGDEQVHIWRRSYDVL
PPAMAKDDPYSAHTDRRYANLDDTVIPDAENLKVTLERALPYWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDDIMGVEIPNFPPLVFEFDENLNVTAEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattagtatttgctcgtcatggtgaatcagaatggaacaaggctaaccttttt
actggctgggctgatgttgacctttcagaagaaggaacgcaacaagcaattgatgccggc
aaactcattaaagaagcagacatcaaatttgaccttgctttcacatcagttttgacacgt
gcaatcaagacaactaatttggcgcttgaatattctgatcaactttgggtaccagttgaa
aagtcatggcgtttgaatgaacgtcactatggtggcttgactggtaaaaataaagctgaa
gctgctgaaaaatttggagacgaacaagttcacatttggcgtcgctcatatgatgtattg
ccgccagctatggccaaagacgatccatactcagcacacactgaccgtcgttatgcaaat
cttgatgatactgttattccagatgcagaaaacttaaaagtcaccttagaacgtgctctt
ccatactgggaagataaaattgctccagctcttaaagatggaaaaaatgtatttgttgga
gcacatggtaactctatccgtgctcttgtaaaacatatcaaacaattgtcagatgatgac
attatgggtgttgaaattccaaacttcccaccattagtttttgaatttgacgaaaattta
aatgtcactgctgaatactatcttggtaaataa

DBGET integrated database retrieval system