KEGG   Streptococcus mutans NN2025 (serotype c): SmuNN2025_1429Help
Entry
SmuNN2025_1429    CDS       T01185                                 

Gene name
glk
Definition
(GenBank) putative glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
smc  Streptococcus mutans NN2025 (serotype c)
Pathway
smc00010  Glycolysis / Gluconeogenesis
smc00052  Galactose metabolism
smc00500  Starch and sucrose metabolism
smc00520  Amino sugar and nucleotide sugar metabolism
smc00521  Streptomycin biosynthesis
smc01100  Metabolic pathways
smc01110  Biosynthesis of secondary metabolites
smc01120  Microbial metabolism in diverse environments
smc01130  Biosynthesis of antibiotics
smc01200  Carbon metabolism
Module
smc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
smc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SmuNN2025_1429 (glk)
   00052 Galactose metabolism
    SmuNN2025_1429 (glk)
   00500 Starch and sucrose metabolism
    SmuNN2025_1429 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SmuNN2025_1429 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SmuNN2025_1429 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SmuNN2025_1429 (glk)
Enzymes [BR:smc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SmuNN2025_1429 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: BAH88455
Position
complement(1510970..1511941)
Genome map
AA seq 323 aa AA seqDB search
MAKKLLGIDLGGTSIKFGILTLDGQVQEKWAIETNILEDGKHIVPDIVSSIKHRLELYNL
TKEDFVGIGMGSPGAVDRNLKTVTGAFNLNWAATQEVGTIIEAELGIPFAIDNDANVAAL
GERWVGAGNNNPDVVFVTLGTGVGGGIIADGNLIHGVAGAGGEIGHIIVEPDTGFECTCG
NKGCLETVASATGVVRVARHLAEEYEGISSIKAGIDNGDDVSSKDIFVAAQAGDKFANSV
VEKVTFYLGLATANISNILNPNTVVVGGGVSAAGEFLRSHIESYFKLYAFPQVKQSTKIK
IAELGNDAGIIGAASLAHQFLES
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaaacttttagggattgatcttggtggaacaagtattaaatttgggatttta
actttagatggacaagttcaggagaaatgggctattgaaaccaatattttggaagatggg
aaacatattgttccagatattgtgtcctctatcaagcatcgtttggaactctataattta
actaaggaggattttgttggtattgggatgggatctcctggagctgtggatcgtaatcta
aagactgttacaggtgcttttaatcttaattgggctgctacccaagaggtaggaacaata
attgaagcagaattggggataccatttgctattgataatgatgctaatgttgcagcactt
ggagaacgctgggttggtgcgggtaataataatcctgatgttgtctttgtaacacttggt
acaggtgttggcggcggcattattgctgatggcaatcttattcatggagttgctggtgca
ggtggtgaaattggacatattattgttgagccggatactggttttgagtgtacctgtggc
aataaaggctgtcttgaaacagtggcttcagcaacaggtgtcgtccgtgttgcacgtcat
ttagcagaagaatatgaaggaatttccagtattaaagcgggcattgataatggtgatgat
gtgagcagtaaagatatttttgttgctgcacaggcaggtgataaatttgcaaactcagtt
gttgagaaagttactttctatctaggccttgcaaccgccaatatcagcaatatccttaat
ccaaacacagttgtcgttggaggtggagtatcagctgctggagaattcttgcgctcacat
attgaaagttattttaaattgtatgcttttccacaagtgaagcaatctacaaaaattaaa
attgcggaattaggaaatgacgctggtattattggggcagccagtcttgcacatcagttt
ttagaaagttaa

DBGET integrated database retrieval system