KEGG   Streptococcus mutans NN2025 (serotype c): SmuNN2025_1436Help
Entry
SmuNN2025_1436    CDS       T01185                                 

Gene name
trpC
Definition
(GenBank) putative indoleglycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
smc  Streptococcus mutans NN2025 (serotype c)
Pathway
smc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
smc01100  Metabolic pathways
smc01110  Biosynthesis of secondary metabolites
smc01130  Biosynthesis of antibiotics
smc01230  Biosynthesis of amino acids
Module
smc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SmuNN2025_1436 (trpC)
Enzymes [BR:smc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SmuNN2025_1436 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C Rrp44_CSD1
Motif
Other DBs
NCBI-ProteinID: BAH88462
Position
complement(1516430..1517197)
Genome map
AA seq 255 aa AA seqDB search
MTKEFLSTILKQKQEELAGLIMEEVKPLRLTYRLFDFLKEHQDQLQIVAEVKKASPSMGD
INLDVDIVRQAQMYEAAGAAMISVLTDQVFFKGNIDFLAEISGSVSIPTLAKDFIIDEKQ
IVRSRNAGATVILLIVAALPEKRLKELYDFAAGLGLEVLVETHNLSELEIAHRIGAQIIG
VNNRNLVTFEVDINTSLELSTHFRDDKVYISESGIFTGQDSKLVAPYFNAILVGTALMQA
DNVADKVKELAIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttgactaaagagtttttatctactattttaaagcaaaaacaagaagagctagctggtcta
attatggaagaagtcaaaccgcttcgcttaacctatcgtctctttgattttttaaaagag
catcaagaccagttgcagattgttgctgaagttaaaaaagctagtcccagtatgggagat
atcaacttagatgttgacattgtcagacaagcccaaatgtatgaagccgctggagctgct
atgatttctgttttgacagatcaggtttttttcaagggaaatattgattttttggctgag
atatctggcagtgtcagtattccgaccttggctaaagattttattattgatgagaagcag
attgttcgtagccgtaatgctggtgcgacagttattttgctcattgtggccgctttacca
gagaagagactgaaggaattgtatgactttgctgcaggtttaggactagaagttttagtg
gagacccataatttgtctgaattggaaatagctcatcgtattggagcacagattattggt
gtcaataatcgtaatcttgttacttttgaagtagatatcaataccagcttggagttatct
acccatttccgagatgataaggtttatatttccgaatcaggtatttttacgggacaggac
agtaaactcgtcgctccttactttaatgctattcttgtaggaacggctctcatgcaggca
gataatgtcgctgataaagtaaaggagttggctattgacaaaggttaa

DBGET integrated database retrieval system