KEGG   Streptococcus mutans NN2025 (serotype c): SmuNN2025_1758Help
Entry
SmuNN2025_1758    CDS       T01185                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
smc  Streptococcus mutans NN2025 (serotype c)
Pathway
smc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:smc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SmuNN2025_1758 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:smc03011]
    SmuNN2025_1758 (rplV)
Ribosome [BR:smc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    SmuNN2025_1758 (rplV)
  Bacteria
    SmuNN2025_1758 (rplV)
  Archaea
    SmuNN2025_1758 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: BAH88784
Position
complement(1853793..1854137)
Genome map
AA seq 114 aa AA seqDB search
MAEITSAKAMARTVRVSPRKTRLVLDLIRGKNVADAIAILKFTPNKAARIVEKTLNSAVA
NAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVVVEEK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattacttcagctaaagcaatggctcgtacagtccgtgtttcacctcgtaaa
acacgtcttgtgcttgatcttattcgtggtaagaacgttgctgacgcaatcgcaatcttg
aaattcactccaaacaaagctgctcgtattgttgagaaaactcttaactctgctgtcgca
aatgcagaaaataactttggtttggaaaaagctaatttggtcgtatctgaaactttcgca
aacgaaggaccaacgatgaaacgtttccgtccgcgtgcgaagggttcagcttcaccaatc
aataaacgtacaactcacgttactgtagttgtagaagaaaaataa

DBGET integrated database retrieval system