KEGG   Streptococcus mutans NN2025 (serotype c): SmuNN2025_1777Help
Entry
SmuNN2025_1777    CDS       T01185                                 

Definition
(GenBank) PhlC protein
  KO
K22839  2-acetylphloroglucinol acetyltransferase [EC:2.3.1.272]
Organism
smc  Streptococcus mutans NN2025 (serotype c)
Brite
KEGG Orthology (KO) [BR:smc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SmuNN2025_1777
Enzymes [BR:smc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.272  2-acetylphloroglucinol acetyltransferase
     SmuNN2025_1777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACP_syn_III Thiolase_N ketoacyl-synt Thiolase_C
Motif
Other DBs
NCBI-ProteinID: BAH88803
Position
complement(1875412..1876623)
Genome map
AA seq 403 aa AA seqDB search
MGIKIQVSGVGCTNAPGLPHINKSFKELLVEAAYKALDDAFLSPHLIDGASFSYAGEGEI
GHGGIVPTLVDALGLAPLEGYINIGNCASSHMALLQGCEMIESGRYRHVLVAGFDKMTDI
LPFENYMLMSTDSLYDYNLGFSHIDAFLLQQEYISKYGIQPIKLKEALLKFSTLMKKYGA
VNKVSSNFGKELPTPKELENQPFFGNAMSAGEGASAVILSAMETNNKNSSQEKVIIAGRG
YTNTSHYIPHRYKEKLLHHKNKDSNDEVGMFNGIPLELSINQAYSEAKISSKDLNILELY
DQGLNSFISMEAAGICPKGEAIEYICNGGGTIDSSVAINTDGGNIARGHAGGGASLYQII
EIVKQLQGRASGMQIKKRQYGLSTVIGGAYATAAAIVLKNEEY
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggggataaaaattcaagtaagtggagtaggttgtactaatgctcctggcttaccgcat
attaataaatcctttaaagaactattagtagaagctgcttataaagcattagatgatgct
tttctttcccctcatttaattgatggcgctagtttttcttatgctggagagggagaaatt
ggacatggggggattgttcctacattagtggatgctttaggtttagcgcctctggaaggt
tacattaatattggaaattgtgcaagttctcatatggctcttttacaaggatgtgaaatg
attgaaagcggacgctataggcatgttttagtagcaggttttgataagatgacggacatc
cttccttttgaaaactatatgctaatgtcaacagatagtttgtatgattataacttaggc
ttttcgcatattgatgcttttttattgcagcaggagtacatcagtaaatatggaatccag
ccgataaaactaaaggaagctttgttaaagttttcaacattaatgaagaagtatggtgca
gtcaacaaagtttcttcaaattttggtaaagagcttccaaccccaaaagaacttgaaaac
caacctttttttgggaatgctatgagtgctggggaaggagccagtgctgtcatattatcc
gctatggaaactaataataaaaatagtagtcaagagaaagtgattatagcaggtcgaggg
tatactaacacatcgcattatattcctcatagatataaggaaaagttacttcatcataaa
aataaggattcaaatgatgaagtaggaatgtttaatgggatacctttggagttatccata
aatcaagcgtattcagaagcgaaaataagttcaaaagatctaaatattctagaattgtat
gatcaaggtctcaatagttttatttctatggaagccgcaggtatttgcccgaaaggagaa
gccatagaatatatttgtaatgggggaggaactattgatagttcagtggcaataaataca
gatggtggtaatattgctcgaggtcatgcaggaggaggagctagtttatatcaaattatt
gaaattgtaaaacagcttcaaggaagagcttctggtatgcaaataaagaagcggcaatat
ggtttatcaactgtgataggtggagcatatgcgacagctgctgctattgttttaaaaaat
gaggagtattaa

DBGET integrated database retrieval system