KEGG   Sinorhizobium medicae: Smed_0300Help
Entry
Smed_0300         CDS       T00555                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
smd  Sinorhizobium medicae
Pathway
smd00030  Pentose phosphate pathway
smd00480  Glutathione metabolism
smd01100  Metabolic pathways
smd01110  Biosynthesis of secondary metabolites
smd01120  Microbial metabolism in diverse environments
smd01130  Biosynthesis of antibiotics
smd01200  Carbon metabolism
Module
smd_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
smd_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
smd_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Smed_0300
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Smed_0300
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:smd04147]
    Smed_0300
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Smed_0300
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Smed_0300
Exosome [BR:smd04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Smed_0300
  Exosomal proteins of colorectal cancer cells
   Smed_0300
  Exosomal proteins of bladder cancer cells
   Smed_0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 5321132
NCBI-ProteinID: YP_001325994
UniProt: A6U679
Position
complement(320165..321640)
Genome map
AA seq 491 aa AA seqDB search
MSSQIIPVEPFDYVVFGGTGDLAERKLLPALYHRQMEGQFSEPTRIIGASRASLSHEEYR
NFAADALKEHLKSGEFNEAEVEKFTARLFYVSVDAKSEQGWDDLKKLLDEGKERTRAFYL
AVGPAIFGDISEKIRDHKLITRNTRIVVEKPIGRDLASATELNDTIGKVFREEQIFRIDH
YLGKETVQNLMALRFANALYEPLWNSAHIDHIQITVSESVGLENRAGYYDKAGALRDMVQ
NHILQLLCFVAMEAPTSMDAEAVRDEKLKVLRALKPITASNAEQVTVRGQYRAGASSGGP
VKGYLEELEGGVSNTETFVAIKAEISNWRWAGVPFYLRTGKRMAGRMSEIVITFKQIPHS
IFDQSAGRISANQLMIRLQPNEGVKQSLMIKDPGPGGMRLRNVPLDMSFAEAFAVRNADA
YERLLLDVIRNNQTLFVRRDEVEAAWQWIDPILKAWEMTGQQVQGYTAGTWGPSQSIALI
ERDGRTWNDAI
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccagatcattcccgtcgaaccgtttgactatgtggtgttcgggggcaccggc
gatctagcggagcgcaagctgctgccggcgctttaccaccgtcagatggaaggccagttt
tcggagccgacgcggatcatcggcgcctcgcgcgcaagcctctcccacgaagaataccgc
aacttcgcggccgacgccctgaaggaacatctgaaatccggggagttcaacgaggcggaa
gtcgaaaaattcaccgcgcggctcttctacgtgtccgtcgacgccaagtccgagcaggga
tgggacgatctgaagaagcttctggacgaaggcaaggagcgcacccgcgccttttacctc
gctgtagggccggcgatcttcggcgacatttccgagaaaatacgcgatcacaagctgatc
accaggaacacgcgcatcgtcgtcgagaagcctatcggccgcgacctcgcctccgcgacg
gagctcaacgacacgatcggcaaggtctttcgtgaagagcagattttccgcatcgatcac
tatctcggcaaggaaacggtgcaaaaccttatggcgctccgttttgccaatgcgctttat
gaacccttgtggaattccgcccatatcgatcacatacagatcaccgtttccgaatccgtc
gggctcgaaaatcgggccggctactatgacaaggcgggcgcactgcgagacatggtgcag
aaccatattctccagctcctctgtttcgtggccatggaggcgccgacctcgatggacgcg
gaggccgtgcgcgacgagaagctcaaggtgcttcgcgcgctgaaaccgatcaccgcgtcc
aatgcggaacaggtgacggtccgcggccagtatcgtgcgggcgcatcatccggcggcccg
gtcaagggctatctcgaagagctcgagggaggcgtttccaacacggaaaccttcgtcgcg
atcaaagccgagatcagcaattggcgctgggcgggcgtgcctttctatctgcgcaccgga
aagcgaatggccggccgcatgtcggagatcgtcatcaccttcaaacagattccgcactcg
atcttcgaccagagcgccggacgcatttcggccaaccagctgatgatccgcctgcagccg
aatgagggcgtcaagcagtccctcatgatcaaggacccggggccgggcggcatgcggctg
aggaacgttccgctcgacatgagcttcgcggaggccttcgccgtgcgcaatgccgacgcc
tatgagcgcctgctgctcgacgtgatccgcaacaaccagaccctgttcgtgcggcgcgac
gaggtggaagccgcctggcagtggatcgacccgatcctcaaggcctgggaaatgaccggg
cagcaggtgcaaggctatacggccggaacctgggggccgagccagtcgatcgcgctgatc
gagcgcgacggccgtacctggaacgatgcgatctag

DBGET integrated database retrieval system