KEGG   Sinorhizobium medicae: Smed_0435Help
Entry
Smed_0435         CDS       T00555                                 

Definition
(RefSeq) SMP-30/gluconolaconase/LRE domain-containing protein
  KO
K22217  sugar lactone lactonase
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    Smed_0435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL
Motif
Other DBs
NCBI-GeneID: 5321269
NCBI-ProteinID: YP_001326127
UniProt: A6U6L2
Position
complement(472192..473076)
Genome map
AA seq 294 aa AA seqDB search
MTDLVPFSGHTLCNSKSELGEGPTFDPGTGTAWWFNITGQQLHELHLDSGRKTSHSLPFL
GSVLAVIDPLRQLIASDQGLFIRDTKDFKLSHFARLEDKPGNRSNDGRVHPCGALWIGTM
GRKAEKHAGAIYHVARNRVTKLYSNITIPNGICFSPDGAAAYFTDTDVNHLMRVELDPLT
ALPTGDPVLLSDESANPGGIDGAVCDADGLIWNARWGAGAVEVYKPDGQKVARYALPASQ
PSCPAFVGAKAERLLVTSARQGLNDAEHAADPHAGKTFELGIEVKGRFEPAFRL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacctcgttcccttttccggccacacactctgcaattccaaatccgagctcggc
gagggccccacattcgaccccggtaccggaacggcctggtggttcaatataaccggccag
cagctgcacgagctgcatctcgacagcgggcggaagacgagccactctcttcccttcctc
ggcagcgtgcttgccgtgatcgaccccctgcggcagctgatcgcgtcggatcagggcctt
ttcatccgcgataccaaggacttcaagctcagccatttcgcaaggcttgaagacaagccc
ggcaaccgctccaatgatgggcgcgttcatccctgcggcgcgctgtggatcggcaccatg
gggcgcaaggccgagaaacacgcgggggcgatctaccacgtcgcccgcaatcgcgtcacg
aaactctacagcaatatcacgatcccgaacgggatctgcttctcaccggacggagccgcc
gcctatttcaccgacaccgacgtcaaccacctgatgcgtgtcgaactggatccgttgacg
gcgcttccaaccggcgacccggtgctgctttccgacgagtccgccaatccgggcggtatc
gatggcgccgtctgcgatgccgatgggctgatctggaacgcgcgctggggcgccggcgct
gtcgaggtctataagcccgacggccagaaggttgcccgctacgccctgccggcaagccag
ccgagttgcccggcgttcgtcggtgcgaaagctgaaagactactggtgacttcggcgcgg
caaggcttgaacgatgccgagcacgcagcggacccgcatgccgggaagacattcgaactc
ggaatcgaggtcaaaggacgcttcgagcccgcattccggctttga

DBGET integrated database retrieval system