KEGG   Sinorhizobium medicae: Smed_0559Help
Entry
Smed_0559         CDS       T00555                                 

Definition
(RefSeq) adenylylsulfate reductase
  KO
K00390  phosphoadenosine phosphosulfate reductase [EC:1.8.4.8 1.8.4.10]
Organism
smd  Sinorhizobium medicae
Pathway
smd00920  Sulfur metabolism
smd01100  Metabolic pathways
smd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Smed_0559
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.8  phosphoadenylyl-sulfate reductase (thioredoxin)
     Smed_0559
    1.8.4.10  adenylyl-sulfate reductase (thioredoxin)
     Smed_0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAPS_reduct
Motif
Other DBs
NCBI-GeneID: 5321395
NCBI-ProteinID: YP_001326250
UniProt: A6U6Y5
Position
complement(606893..607669)
Genome map
AA seq 258 aa AA seqDB search
MTTQSLKAEVAAFEAEAKVLNDRLADLDLAGRLALVAGLAGRAVFTTSLGIEDQVITAAI
GGDHLDIQVATLKTGRLFNETVALIDKTEETYGILIKRYYPEKADIDAYVAQHGMNGFYE
SVEARHACCGVRKLKPLARALDGASYWITGLRRGQSGNRATTPFAEADAERGLIKINPLA
DWDIETIQAHVAAEGIPVNPLHSRGYPSIGCEPCTRAIKPGEPERAGRWWWENDEKRECG
LHVPEAASSIIPNASNAA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcaatccctcaaagcagaagtggcggccttcgaagccgaagcaaaggtcctg
aacgacaggctcgcggatctggatcttgccggacggctggcgctcgtggccgggctcgca
ggccgtgcggtcttcaccacctcgctcggcatagaggaccaggtcattaccgccgcgatc
ggcggcgatcatctcgacattcaagttgcgacgttgaagacgggccgcctcttcaacgag
acagtggccctgatcgacaagaccgaggaaacctatggtatcctcatcaagcgctattat
cccgaaaaagccgacatcgacgcctatgtggcgcaacacggcatgaacggtttttacgaa
agcgtcgaagcccggcatgcctgttgcggcgtgcgcaagctgaagccgcttgcgcgcgcg
ctcgacggggcaagctactggatcacgggcctgcgccgcgggcagtcgggcaaccgtgcc
acgacccctttcgccgaagccgatgctgagcgcgggctcatcaagatcaatccgctcgcc
gactgggacatcgagacgatccaggcccatgtcgcggcggagggcattcccgtcaatccg
ctgcacagtcgcggttatccgtcgatcggttgcgagccctgcacccgtgccatcaagccc
ggcgagccggagcgcgccggacgctggtggtgggagaacgacgagaagcgcgaatgcggc
ctgcacgttccggaagcggcttcctcgatcattccgaatgccagcaacgcggcctga

DBGET integrated database retrieval system