KEGG   Sinorhizobium medicae: Smed_0561Help
Entry
Smed_0561         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2214
Motif
Other DBs
NCBI-GeneID: 5321397
NCBI-ProteinID: YP_001326252
UniProt: A6U6Y7
Position
608333..608812
Genome map
AA seq 159 aa AA seqDB search
MEEALTWIGALPVAGAIRRSAVLYIFVNAAHILSIGIIVGSILPLDLRLLGFFPDVPVGV
IGPYLSRAAAIGIASAMATGLCLFSVRPVEYAGNPAFLTKMTLLAIGVLNAVLLHMTPQW
RDAVKGGPLSLSVRVSALLSMSIWTGAVLSGRWIGFLSE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggcgctgacatggatcggggcgctgcccgtcgccggggcgatacggcgctcc
gcagtgctctatattttcgtgaatgccgcccacatactctcgatcgggatcatcgtcggt
tcgatcctgccgctcgacctgcggctgctcggcttctttcccgacgtgccggtcggagtg
atcggaccctatctttcgcgcgcggcggcaatcggcatcgcgtccgccatggccacgggc
ctctgcctcttcagcgttcgtccggttgaatatgccggcaaccctgcattcctgacgaag
atgacgctgctggcgattggcgtcctcaacgccgtcctattgcacatgacgccgcaatgg
cgcgatgccgtcaaaggcgggccgctctccctgagcgtccgagtttcggcactgctttcc
atgtcgatctggaccggcgcggtcctttccggccgctggataggcttcctgtccgagtga

DBGET integrated database retrieval system