KEGG   Sinorhizobium medicae: Smed_0563Help
Entry
Smed_0563         CDS       T00555                                 

Definition
(RefSeq) betaine aldehyde dehydrogenase
  KO
K00130  betaine-aldehyde dehydrogenase [EC:1.2.1.8]
Organism
smd  Sinorhizobium medicae
Pathway
smd00260  Glycine, serine and threonine metabolism
smd01100  Metabolic pathways
Module
smd_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smed_0563
Enzymes [BR:smd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.8  betaine-aldehyde dehydrogenase
     Smed_0563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 5321399
NCBI-ProteinID: YP_001326254
UniProt: A6U6Y9
Position
complement(610662..612125)
Genome map
AA seq 487 aa AA seqDB search
MRAQPKASHFIDGEYVEDAAGTVIESIYPATGEVIARLYAATPAIVEKAIAAAKRAQPEW
AAMSPTARGRILKRAAEIMRERNRELSELETLDTGKPIQETIVADPTSGADSFEFFGGIA
PAALNGDYIPLGGDFAYTKRVPLGVCVGIGAWNYPQQIACWKGAPALVAGNSMVFKPSEN
TPLGALKIAEILIEAGLPKGLYNVVQGDRSTGPLLVNHPDVAKVSLTGSVPTGRKVYEAA
AAGLRHVTMELGGKSPLIVFDDADLESAIGGAMLGNFYSTGQVCSNGTRVFVQKKIKQSF
LARLKERTDAIVIGDPMDEATQLGPMVSTAQRDKVFSYIEKGKSEGARLVTGGGIPNNVS
AEGTYIQPTVFADVTDEMTIAREEIFGPVMCVLDFDDEAEVVARANATEFGLSAGVFTAD
LTRAHRVVDRLEAGTLWINTYNLCPVEIPFGGSKQSGFGRENSAEALKHYTELKTVYVGM
GPVEAPY
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagagcccaaccgaaagcctcgcacttcatcgacggcgaatatgtcgaggacgccgcc
ggcacggtgatcgaaagcatctatccggcgaccggcgaagtgatcgcccgcctctatgct
gcaacgcccgcaatcgtcgagaaggcgatcgccgcggccaagcgggcgcagccggaatgg
gcggcgatgagcccgacggctcgcggccgcatcctgaagcgggccgccgagatcatgcgc
gagcgcaaccgggagctctccgaactagagacgctcgacacgggcaagcccatccaggaa
accatcgtcgccgacccgacctcgggcgccgacagcttcgagttcttcgggggtatcgcc
ccggccgccctcaatggcgattatatcccgctcggcggcgatttcgcctatacgaagcgg
gtacctctcggcgtctgtgtcggcatcggcgcctggaactatccgcagcagatcgcctgt
tggaagggtgcgcctgccctcgtcgccggcaattcgatggtgttcaagccgtcggagaac
acgcctctcggcgcgctgaagatcgccgaaatcctgatcgaagcgggtctgccgaagggc
ctgtacaacgtcgttcagggcgaccgatcgactggacccctcctcgtcaatcatcctgac
gtcgccaaggtatcgctgaccggctcggtgccgaccggccgcaaggtctatgaggcggcc
gcggccggacttcgccacgtcacgatggagctcgggggcaagtcgccgctgatcgtcttc
gacgatgccgatctcgaaagcgcgatcggcggcgccatgctcggcaatttctattcgacc
ggtcaggtctgctccaacggcacgcgcgtcttcgttcagaagaagataaagcaatccttc
ctggcgcggctgaaggagcgtaccgatgcgatcgtcatcggggacccgatggacgaggcg
acgcagctcgggccgatggtatccacggcgcagcgtgacaaggtcttctcttatatcgag
aaaggcaaatcggagggcgcgcggctcgtgaccggcggcggcatccccaacaatgtgagc
gccgaaggcacctatatccagccgacggtctttgccgatgtcaccgacgagatgaccatc
gcgcgcgaagaaatcttcggcccggtcatgtgcgtgcttgatttcgatgacgaggcggag
gtcgtcgcacgcgccaacgccaccgaattcggcctctccgccggcgtcttcaccgccgac
ctcacccgcgcccatcgcgtcgtcgaccggctggaggccggaacgctctggatcaacacc
tataatctctgcccggtcgagattccgttcggcggatccaagcagtccggcttcgggcgc
gagaattcagccgaagcgctcaaacactataccgagctcaagaccgtctatgtcggcatg
ggaccggtcgaggcgccgtattga

DBGET integrated database retrieval system