KEGG   Sinorhizobium medicae: Smed_0564Help
Entry
Smed_0564         CDS       T00555                                 

Definition
(RefSeq) sulfatase
  KO
K01133  choline-sulfatase [EC:3.1.6.6]
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Smed_0564
Enzymes [BR:smd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.6  choline-sulfatase
     Smed_0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfatase Choline_sulf_C Phosphodiest DUF229 DUF4976 Metalloenzyme DUF1501
Motif
Other DBs
NCBI-GeneID: 5321400
NCBI-ProteinID: YP_001326255
UniProt: A6U6Z0
Position
complement(612127..613665)
Genome map
AA seq 512 aa AA seqDB search
MTTGKPNILIIMVDQLNGKLFPDGPADFLHAPNLKALAKRSARFRNNYTSSPLCAPARAS
FMAGQLPSRTRVYDNAAEYQSSIPTYAHHLRRAGYYTALSGKMHFVGPDQLHGFEERLTT
DIYPADFGWTPDYRKPGERIDWWYHNLGSVTGAGVAEITNQMEYDDEVAFLANQKLYQLS
RENDDESRRPWCLTVSFTHPHDPYVARRKFWDLYEDCEHLTPEVEAIPLDKQDSHSQRIM
LSCDYRNFDVTEENVRRSRRAYFANISYLDEKVGELIDTLTRTRMLDDTLILFCSDHGDM
LGERGLWFKMNFFEGSARVPLMIAGPGIAPGLHLTPTSNLDVTPTLADLAGISLEEVGPW
TDGVSLVPMVNGVERTQPVLMEYAAEASHAPLVAIREGKWKYVYCTLDPEQLFDLEADPL
ELSNLAEKPRGPVDQATLTAFRDMRAAHWDMEAFDASVRESQARRWVVYEALRNGAYYPW
DHQPLQKASERYMRNHMNLDNLEESKRYPRGE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccgggaagccaaacattctgatcatcatggtggaccagttgaacggaaagctc
tttccggacgggcctgccgacttcctgcatgcgcccaacctgaaggcgctggccaagcga
tcggcacgctttcgcaacaactacacctcgtcgcccctgtgtgcccccgcccgcgcgtcc
ttcatggcgggccagttgccgagccgcacgcgggtttacgacaatgcggccgagtaccag
tcctcgatcccgacctacgcgcatcacctgcgccgggccgggtactacacggcgctttcc
ggcaagatgcacttcgtcggcccggaccagttgcatggtttcgaggagcggctgacgacc
gatatctatccggccgatttcggctggacaccggactaccggaagcccggcgagcgaatc
gactggtggtatcacaatcttggctccgtaaccggagcgggtgtcgccgaaatcaccaac
cagatggaatatgacgacgaggtcgcgttcctcgcaaaccagaagctctaccagctttcg
cgagaaaacgacgacgaaagccggcgcccctggtgcctcaccgtctccttcacacacccg
cacgacccctatgtcgcgcgaaggaaattctgggacctctacgaggattgcgagcacctc
acgcccgaggtcgaagccatcccgctcgacaagcaggactcgcattcgcaacgcatcatg
ctctcctgcgactaccggaatttcgacgtgaccgaagaaaatgtccgccgctcgcgccgc
gcctatttcgccaacatctcctatctcgacgagaaggtcggcgaattgatcgatacgctc
acacggacgcggatgctggacgacacgctcatcctcttctgttcggaccacggcgacatg
ctcggcgagcgcggcctctggttcaagatgaactttttcgaaggctcagcgcgcgtgccg
ctgatgattgccggacccggcatcgcgccgggcctccatctgacaccgacctccaacctc
gacgtgacgccgacgcttgcggatctcgccggcatctcgctcgaggaagtgggaccctgg
accgatggcgtcagcctcgtgccgatggtcaacggcgtcgagcgcacgcagccggtgctg
atggaatatgccgccgaagcctcccatgcgccgctggtcgccatccgcgagggcaagtgg
aaatatgtttactgcacgctcgatccggagcagttgttcgacctggaggcagacccgctg
gaactcagcaacctcgctgaaaagccgcgcggcccggtcgaccaggcgacgctcacggcc
ttccgagacatgcgcgctgcgcattgggacatggaggccttcgatgcctccgtgcgcgaa
agccaggcccggcgttgggtggtctacgaagcgcttcgaaacggcgcctactatccctgg
gaccaccagccgctgcagaaagcttcggagcgctacatgcgcaatcacatgaacctcgac
aatctcgaggaatccaaacgctatccgcgaggagaatga

DBGET integrated database retrieval system