KEGG   Sinorhizobium medicae: Smed_0574Help
Entry
Smed_0574         CDS       T00555                                 

Definition
(RefSeq) PAS/PAC and GAF sensor-containing diguanylate cyclase/phosphodiesterase
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EAL GGDEF PAS_4 GAF_2 GAF PAS PAS_9 PAS_3 Cache_3-Cache_2
Motif
Other DBs
NCBI-GeneID: 5321410
NCBI-ProteinID: YP_001326265
UniProt: A6U700
Position
622989..625307
Genome map
AA seq 772 aa AA seqDB search
MADKTSRSIRYADLNAGDNAETRRLIDAGNRLADEVARLFPSQPDIADRHYWLEAMINHV
PDYIYAKDTEGRFLIANEVTVADNGLESLQDLVGKTDFDLHPHEFAQAVAGTERRVLETG
EPIFGIEERAIVTKGRDRWLMTSKVPLRSKSGKIIGIVGISRDITDRKSAERLLEGQARL
LEMIAKGKPLTEFFNELVLLIEALLPGIKGSILLLSEDGRHLLHGAAPSLDRAYSAAVHA
LEIGPNAGSCGTAAWRGEQVIVSDVYADPLWADYALLLKSSGLRSCWSTPILSRERKVLG
TFALYAHEVATPCEQEQELIAMAAHLAGIAIERKRAEDRISFLAHHDALTGLPNRVLFEE
QVDGMLEEIRERDQCAVLAFLDLDNFKLINDSLGHAAGDELLKAVAGRMRASVRKADFVV
RVGGDEFIILLNGLPKERDIVLSRLEDIRSAIAMPLQLQGRSLQVSCSMGVACFPNQGRT
AGELLANADMAMYRAKELGRDNIQVFTEEMAARAHERLQWQEELREALAGEEFLLHFQPQ
MNLGTGRIFAAEALLRWNHPVRGIISPSVFIPLAEETGLIVPIGDWALRAACRQLKAWQD
AGLPPLIISVNVSARQFRERNWASRVAEILKETGLEARYLELELTESLIMQDVPGAIATM
HALEAIGVHLAIDDFGTGYSSLSALKRFPVRRLKIDRSFVTDIPLDADDMAITSAIISLA
QKLGLRVIAEGVESEAQVEFLQKAGCDEIQGYFFSRPLSAEAFESLLSSARP
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
ttggcagacaagacgtcccgcagcatccgttatgccgacctgaacgcgggcgacaatgcg
gaaacgcgccggctgatcgatgccggcaatcgcctcgccgacgaagtcgcacgcctgttt
ccgtctcagccggatattgccgaccgccactattggctcgaggcgatgatcaaccacgtc
ccggactacatctatgccaaggacacggagggccgtttcctgatcgccaatgaggtgacg
gtcgccgacaatggcctcgaaagcctgcaggatctcgtcggcaagaccgatttcgatctg
catccgcatgaatttgcccaggcggtcgctggtacggagcggcgtgtgctggagaccggc
gaaccgatttttggtatcgaggaacgtgcgatcgtcacgaagggccgcgaccgttggctc
atgacctcgaaagtgcccttgcggagcaagagcggaaagatcatcggcatcgtcggcatc
tcgcgtgacatcaccgatcggaagtcggcggagcgcctgctcgaagggcaggcccggtta
ttggaaatgatagccaagggcaagccgctgaccgaattcttcaacgagctggtgctgctg
atcgaggcacttcttcccggtatcaaaggctctatcctgcttttgtccgaagacggccgg
catctcctgcacggcgctgctcccagcctcgaccgggcgtatagcgctgctgttcatgcg
ttggaaataggcccgaatgcgggctcttgcggaacggccgcctggcgcggcgaacaggtc
atcgtctccgatgtctacgccgacccgctctgggcggactacgctcttctcctgaaatct
tccggtctccgttcctgctggtccacgcccatcctgtcgcgcgagcgcaaggtgctcggc
acattcgcgctctacgcacatgaggtcgcaaccccttgcgagcaggagcaggaactgatt
gccatggccgctcacctcgccggaatcgccatcgagcgcaagcgggcggaggaccgtatc
agtttcttggcccaccatgacgccttgacgggcctgccgaaccgcgtcctttttgaagag
caggtcgacggcatgctcgaggagatccgcgagcgggaccaatgcgccgtgctcgccttt
ctcgacctcgacaatttcaaactgatcaacgacagccttggccacgcggcaggtgatgag
ctcctgaaagccgtcgcagggcgcatgcgggcctccgtgcggaaagccgattttgtcgtg
cgcgtcggcggcgacgagttcatcattctcctgaacgggttgccgaaggagcgggatatc
gtgctgtcgcggcttgaggacatccgctctgcaatcgccatgccgctgcagttgcagggc
cgctccctgcaggtcagctgcagcatgggagtggcttgcttccccaaccagggaagaacg
gcgggtgaactgctcgccaacgccgacatggccatgtaccgcgccaaggaactcggccgc
gacaacatacaggtctttaccgaggagatggcggcaagagctcatgaaagactccaatgg
caggaggagcttcgtgaggcacttgcgggggaggagttcctgctgcatttccagccgcag
atgaatctcggcaccgggcgcatcttcgcggcggaggcactgttgcgttggaaccacccg
gtgcgcggcatcatctcgccttcggtgttcatcccgctcgccgaggagaccgggcttatc
gtgccgatcggagactgggcgctgcgtgccgcctgtcgccagctgaaggcctggcaggat
gccggcctgccaccgctgatcatcagcgtcaatgtttccgctcggcagttccgcgaacgc
aactgggcatcgcgggtggcggaaattctgaaggagaccgggctcgaggcccgttacctc
gagctcgagctcaccgagagtctcatcatgcaggacgtgccgggggcaatcgccacaatg
cacgcgctggaagcgatcggcgttcaccttgcgatcgatgatttcgggacgggctattcc
agcctcagtgcgcttaagcgctttccggtacgccgtctgaaaatcgaccggtccttcgtt
acggacattccgctcgatgccgacgacatggcgatcacgtccgccattatctcgcttgca
cagaagctcggcctgcgtgtgatcgccgagggtgtcgagagcgaggcgcaggtcgagttt
ctccagaaggccggctgcgacgaaatccaaggctatttcttcagccgtcctttgtcggcc
gaggctttcgaaagcctgctttcctccgcgcggccgtaa

DBGET integrated database retrieval system