KEGG   Sinorhizobium medicae: Smed_0575Help
Entry
Smed_0575         CDS       T00555                                 

Definition
(RefSeq) ErfK/YbiS/YcfS/YnhG family protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YkuD
Motif
Other DBs
NCBI-GeneID: 5321411
NCBI-ProteinID: YP_001326266
UniProt: A6U701
Position
625670..626353
Genome map
AA seq 227 aa AA seqDB search
MNTDRFRQQTMPVYRNPALESRWGPPGGIYEGPVGEGPIGLPPQDAYYAEIYAAQEDGGF
LVPAVPFRQIDPRFYRQEVSDPFGEAPGTIVVDTADRYLYLIQPRGRAMRYGVGLGREGF
AWSGRGVIQWKQKWPKWTPPNEMVARQPVLAKYSADNGGMPPGLDNPLGARALYIFQNGQ
DTLYRVHGSPEWQSIGKAVSSGCVRLINQDVIDLYDRVRNKSPILVV
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgaccgcttccgccagcagacaatgccggtctaccgcaaccctgcgctggaa
agccgttggggcccgccgggcggcatttatgaggggccggtgggcgagggaccgatcggc
ttgccgccccaggacgcctattacgcagagatctatgcagcgcaggaggacgggggattc
ctcgttccggccgtgccattcaggcagatcgatccgcggttctatcgtcaggaggtcagc
gatccttttggcgaggctcccggcacgatcgtcgtcgacacggccgaccgctatctctac
ctgatccagccgcgcgggcgtgcgatgcgctacggcgtcggcttgggccgggaagggttt
gcatggtcgggccgcggcgtgattcaatggaagcagaaatggcccaagtggacgcccccg
aacgagatggtggcccgtcagccggtactggcgaaatattccgcggataatgggggcatg
cccccgggcctggacaacccgcttggggcacgcgcgctttatatcttccagaacggtcag
gatacgctctatcgtgtccatggctcgcctgaatggcagtcgatcggcaaagcggtgtca
tcgggttgcgtgcgcttgatcaaccaggacgtgattgatctttatgatcgtgtgcgcaac
aagtcgccgatcctcgtcgtctga

DBGET integrated database retrieval system