KEGG   Sinorhizobium medicae: Smed_0578Help
Entry
Smed_0578         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
  KO
K06915  uncharacterized protein
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Smed_0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF853 AAA_22 FtsK_SpoIIIE ResIII DUF87 AAA_10 TrwB_AAD_bind AAA Zot AAA_30 AAA_18 T2SSE AAA_28 Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 5321414
NCBI-ProteinID: YP_001326269
UniProt: A6U704
Position
complement(627547..629109)
Genome map
AA seq 520 aa AA seqDB search
MLQEGKIYIGTSRKPDDSINKGEYLELKFGNRHGLITGATGTGKTVTLQILAEGFSNAGV
PVFCADVKGDLSGIGAMGESKDFLLKRAEQIGLEPYDFQEFPVIFWDLYGEKGHRVRTTI
SEMGPLLLSRLMNASDAQEGVLNIAFKIADEGGLPLLDLKDLRALLNYMGENAGELSNQF
GFISKASVGSIQRELLILEQQGAEHFFGEPALKITDIMRTTNDGRGAISVLAADKLMMNP
RLYATFLLWLLSELFEELPEVGDPDKPKLVFFFDEAHLLFNDAPKVLVERVEQVVRLIRS
KGVGVYFVTQNPLDVPEAVLAQLGNRVQHALRAYSPREQKAVKTAADTFRPNPDFNCADV
ITNLGTGEALVSTLEGKGSPSIVERTLVRPPASRLGPLTEAERQHVISLSPVRGLYDEDF
DRESAYEMLAKRAAKAAEQAEAAQRAEERASEETSGGGRWTLPGFGDDAAEAPSGKRART
RSSGYQRETIVEAAMKSVARTVATQVGRALVRGILGSLKR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggaaggcaagatctacatcggaaccagccgcaagccggacgattcgatcaat
aaaggcgaatatctggagctcaaattcggcaatcgccacggtctgatcacaggcgcgacc
gggaccggcaagaccgtgacgctgcaaatcctggccgagggtttctcgaatgccggcgta
ccggtattctgcgccgacgtgaagggcgacctatccggcatcggcgcgatgggcgagtcg
aaggacttcctgctcaagcgcgcggagcagatcggcctcgagccttatgattttcaggaa
tttccggtgatcttctgggatctctacggcgagaaggggcacagggtccggaccaccata
tcggagatggggcccctccttctgtcgcggctgatgaacgcgtccgacgcccaggaaggt
gtgttgaacatcgccttcaagatcgccgatgagggcggattgccgctactcgacctcaag
gacctgcgggcgctgctcaattacatgggcgagaatgcaggcgagctatccaatcagttc
ggcttcatctccaaagcctccgtcggctcgatccagcgtgaactcctgatcctggaacag
cagggggcggagcatttctttggtgagccggcactgaagatcaccgacatcatgcggacc
accaatgacgggcgcggcgcgatttcggttcttgccgccgacaagctgatgatgaacccg
cggctctacgcaaccttcctgttatggctcctgtcagagcttttcgaggaacttcccgaa
gtgggtgacccggataagccgaagctggtgttcttcttcgacgaagcgcatttgctcttc
aatgatgcgcccaaggtcctcgtcgaacgcgtcgagcaggttgtccgcctgatccgctcg
aagggcgttggcgtctatttcgtcacccagaacccgctcgacgtcccggaggcggtcctc
gcccagcttggaaaccgtgtccagcatgcgttgcgcgcctattccccccgcgaacagaag
gcagtcaagacggctgccgatacgttccgccccaaccccgacttcaattgcgccgacgtg
atcaccaatctcggtaccggcgaggctctggtttcgacgctggagggcaaaggctcgccg
tcgattgtcgagcggaccctggtgcgtccgccggcgtcccggctcggtccgcttaccgag
gccgagcggcagcatgtcatcagcctcagccccgtgcgcggcctctacgatgaggacttc
gaccgggagtcggcctatgaaatgcttgccaagcgtgcggccaaggctgcggaacaggcg
gaagcagctcagcgagcagaagaacgggcctctgaggagacttccggcggcggccgttgg
acactgcccggcttcggcgacgacgcggcggaagcgccgtcgggcaagcgggctaggacg
cgctcttccggctaccaacgggaaaccatcgtggaggcggcgatgaagtccgtcgcgcgg
acggtcgcgacccaggtgggacgggctcttgtccgcggcattctcggcagtctgaagcgt
tag

DBGET integrated database retrieval system