KEGG   Sinorhizobium medicae: Smed_0579Help
Entry
Smed_0579         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2780 DUF937 DUF2267
Motif
Other DBs
NCBI-GeneID: 5321415
NCBI-ProteinID: YP_001326270
UniProt: A6U705
Position
629400..629792
Genome map
AA seq 130 aa AA seqDB search
MSELVTRVAENVGIEAATAEKAVGMILGFLQREAAEGPVAQMIEAIPGAPELVARYNGEG
SDGGGLLGGLMSAIGGGGVMALGQQLMSQGLGMGEITALAKETIAFAKEKAGEDVVDEVV
ASVPGLSQFV
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaactggtcacgcgcgtggcggaaaatgtcggcatcgaggctgcaacggctgaa
aaggcggtcggcatgatccttggtttcctgcagcgtgaggccgccgaaggcccggtcgcc
caaatgatcgaggcgatccccggcgcacccgagctggtcgcccggtacaatggcgagggc
agcgacggtggcggtctccttggcggcctgatgtcggcaatcggcggcggcggcgtcatg
gcgctcggacagcaattgatgagccaggggcttggcatgggagagatcacggcactcgcc
aaggaaaccatcgcctttgccaaggagaaggcgggtgaggacgtcgtggacgaagtcgtc
gcatccgttccaggtctcagccagttcgtgtga

DBGET integrated database retrieval system