KEGG   Sinorhizobium medicae: Smed_0581Help
Entry
Smed_0581         CDS       T00555                                 

Definition
(RefSeq) trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Smed_0581
Enzymes [BR:smd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     Smed_0581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_12 Methyltransf_23 Methyltransf_5 MTS
Motif
Other DBs
NCBI-GeneID: 5321417
NCBI-ProteinID: YP_001326272
UniProt: A6U707
Position
complement(630815..631588)
Genome map
AA seq 257 aa AA seqDB search
MAWSAAQYTKFEDERTRPARDLLAQVTELPDGPAFDLGCGPGNSTELILNRFRDNPLTGI
DSDEDMLSAARTRLPELRFEKADLASWVPPAESALFFANAVFQWLPEHIVLFERLILALA
PGGTLAVQMPDNLDEPTHVLMEETAEESAFASAFAGRAARRKSLPSPANYVERLTAKDVR
IDVWHTVYYHQLANANAIVEWVKGTGLRPYLDALPAARRAGYLAAYADKIRKAYPTMKDG
RVLLRFPRLFIVATRNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcttggtcggcagcgcagtataccaaatttgaagacgagcggacgcgtccggcgcgc
gacctgctggcgcaggtaaccgagctgcctgacggccccgccttcgaccttggttgcgga
cccggcaattcgaccgagttgattctcaatcgtttcagagacaacccgcttaccggaata
gacagcgacgaggacatgctttcggccgcgcgaacgcgcttgccggagctgcgcttcgaa
aaggccgatcttgcgagttgggtaccgccggcggaaagcgccctcttctttgccaacgcg
gttttccagtggctgccggagcacatcgtgctgttcgagcggctcatccttgcattggcg
cccggcgggacgctcgcggtgcaaatgcccgacaacctggatgagccgacgcacgtcctg
atggaggaaacggcagaggagtctgcttttgcttcagcctttgccggccgcgccgcacga
cgcaagtccctgccctcacccgcgaactacgtcgagaggctgacagccaaggacgtccgg
atcgatgtctggcacaccgtgtattatcaccaactcgcaaatgcgaacgccatcgtcgaa
tgggtaaagggcacgggattgcgcccctatctcgacgcgctgcccgccgcccgtcgggcc
ggttacctcgccgcctatgccgataaaatcaggaaggcttatccgacgatgaaagacggg
cgtgtgctcttgcgtttcccgcggcttttcatcgtggcaacgagaaaccgctag

DBGET integrated database retrieval system