KEGG   Sinorhizobium medicae: Smed_0594Help
Entry
Smed_0594         CDS       T00555                                 

Definition
(RefSeq) beta-lactamase
  KO
K17836  beta-lactamase class A [EC:3.5.2.6]
Organism
smd  Sinorhizobium medicae
Pathway
smd01130  Biosynthesis of antibiotics
smd01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    Smed_0594
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    Smed_0594
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:smd01504]
    Smed_0594
Enzymes [BR:smd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     Smed_0594
Antimicrobial resistance genes [BR:smd01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    Smed_0594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-GeneID: 5321430
NCBI-ProteinID: YP_001326285
UniProt: A6U720
Position
641373..642263
Genome map
AA seq 296 aa AA seqDB search
MPLHITRREMLAASAMLYPALALGTPAHAATAADDDVTERLRQLEERTGGRLGVAVLDME
TNISFGYRETERFAMCSTFKALAAACALARVDRGEEKLDRRITFGKEVLLPHSPVTEKHV
GGNGMTIAELCEAAITISDNAAGNLLLESFGGPQGLTSWLRSIGDNTTRLDRTEPDLNEA
RKGDPRDTTTPAAMLDTLGKLALGSVLSENGRGQLVDWLVANETGDARLRAGLPKDWRIG
DKTGTSSTGAVSDIALAWPPGRGPLLVAVYTGEAKAPVSDLNPVFAEIGKIAAEIV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgcacataacccgccgagaaatgctggccgcctcggccatgctctatccggcg
ctcgccctgggaacgccggcacatgcggccactgcggcggacgatgacgttacggaacgg
cttcgtcagcttgaagagcgtaccggcggacgtttgggcgtcgctgtgctcgatatggaa
acgaatatctcgttcggataccgggagaccgagcgtttcgcaatgtgttctaccttcaag
gcgctcgcggcggcttgtgcgctcgcccgcgtggatcggggggaggaaaaactcgaccgg
cggatcacgttcggcaaggaggtcttgctgcctcattcgccggtaaccgaaaagcacgtc
ggcggaaacggcatgaccatcgcggaactttgcgaagcggcgatcaccatcagcgacaat
gccgctggcaacctgctgctcgaaagtttcggaggtccacaggggctgacgtcgtggcta
cgctcgattggcgacaataccacgcgcctcgaccgaacggagcccgacctgaacgaagcc
cgcaagggcgatccgcgcgacaccaccacaccggccgccatgctggacacgcttggaaaa
ctggctctcggctcggtcctgtccgaaaacgggcgcggacagctcgtcgactggttggtt
gccaacgaaaccggtgacgcgcgccttcgcgcggggctgcccaaggattggcgcatcggc
gacaagacagggaccagctccaccggcgcagtctccgacatagcgctcgcctggccgccc
ggccgcggcccactcctggttgccgtctataccggtgaagcgaaagcgccggtcagcgac
ctgaatccggtctttgcggaaataggcaagatcgccgccgagatcgtttga

DBGET integrated database retrieval system