KEGG   Sinorhizobium medicae: Smed_0600Help
Entry
Smed_0600         CDS       T00555                                 

Definition
(RefSeq) LysR family transcriptional regulator
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 MarR_2 HTH_30 HTH_20 HTH_8 HTH_24
Motif
Other DBs
NCBI-GeneID: 5321436
NCBI-ProteinID: YP_001326291
UniProt: A6U726
Position
complement(650504..651436)
Genome map
AA seq 310 aa AA seqDB search
MELLMDSLRGIESFVRSVEEGSIAAAARRLGITPAAASQNIARLERALGIRLLVRTTRQS
GLTEAGRLYYDRVREVISELEQAAAAVSVLNEEPRGRLKIASSVAFGRHVIAPLVPSFAA
RYPDVSIELVVTDRSIDHIGEGIDISVRFAQQLEPGLITRKLGSVPLVICAAPSYIARRG
RPETPEDLRHHDCLIYRFAGHGRLFRWAFVRDGLRFEPELRPTIVSNDIDTLAQMAIAGA
GITRLGTFIANQFFEQGLLVPLFGEAAAEDGTRVDHEPLDFYACFLDRQAETPKVRSFID
HAVQSLQGRW
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggaattgctaatggatagcctgcggggcatagaaagcttcgtgcggagcgtggaggaa
ggcagcatcgctgcagccgcccgcaggctcgggatcacgccggctgctgcaagccagaac
atcgcccggctcgagcgcgcgctcggaattcgccttctcgtccgcaccacccgacaatcg
gggctgaccgaagccggacggctttattacgaccgcgtgcgcgaagtgataagcgagctc
gagcaggcggcggccgccgtgtcggttctcaacgaggaaccccgcggtcgactgaagatc
gcctcttccgtggctttcggccgccatgtcattgcgcccctggtgccatcctttgcagca
cgatatccggatgtctcgatcgaactggtggtgacagaccgcagcatcgaccacataggc
gaaggaatcgatatcagcgttcgctttgcccagcagctcgagccggggctcattacgcga
aagctcggctcggttccgctggtgatatgcgcggcgccgtcctacatcgcccggcgcggc
cggcccgagaccccggaggatctgcggcaccacgactgcctgatctatcgcttcgccggc
cacggccggcttttccgctgggccttcgttcgtgatggccttcgcttcgagcccgaattg
cgcccgacgatcgtcagcaatgacatcgacactttggcccagatggcaatcgccggcgcg
ggcattacccggctcggcacgttcatcgccaaccagtttttcgagcaaggcctgctcgtg
ccgcttttcggagaagccgccgccgaagatggcacgcgcgtggatcacgaaccgctcgat
ttctacgcctgtttcctcgatcgtcaggccgaaacaccgaaggtgcgctctttcatcgac
cacgcagtgcagtcgctacaggggaggtggtga

DBGET integrated database retrieval system