KEGG   Sinorhizobium medicae: Smed_0603Help
Entry
Smed_0603         CDS       T00555                                 

Definition
(RefSeq) UspA domain-containing protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Usp
Motif
Other DBs
NCBI-GeneID: 5321439
NCBI-ProteinID: YP_001326294
UniProt: A6U729
Position
653060..653554
Genome map
AA seq 164 aa AA seqDB search
MTDGKLREAPHWGAAWQHRKGRNSMYKKIIVPIAMDQLEHGESVLGIAVKLIDEGGEIIL
LNVVEDLNAYAQGYMIVDFPLEMIEESRKHAVKTLEALRTKHGINGRVEIRTGGAAGSIN
ALAKEENADLVIIASHRPGLIDYFIGSTASRVVSHCPCAVLIDR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgactgacggtaagctgagggaggcgccgcattggggtgcggcgtggcaacataggaag
ggacgtaatagcatgtacaaaaagatcatcgtgccgatcgccatggatcagctggagcat
ggcgagtccgttctcggcattgcggtgaagctgatcgatgaagggggagagatcattctg
ctcaatgtcgtcgaggatctcaacgcctatgcacaaggctatatgatcgtcgattttccg
ctggagatgatcgaagaatcgcgcaagcacgcggtcaagaccctggaagcactgaggacc
aagcacggcatcaacggacgcgtggaaatccgcacaggcggtgcggcaggcagcatcaac
gcccttgcaaaggaagagaatgccgacctggtgatcatcgcgtcgcaccgaccgggcttg
atcgattacttcatcggatccaccgccagccgcgtcgtcagccattgcccctgcgcggtt
ctcatcgatcggtaa

DBGET integrated database retrieval system