KEGG   Sinorhizobium medicae: Smed_0611Help
Entry
Smed_0611         CDS       T00555                                 

Definition
(RefSeq) putative monovalent cation/H+ antiporter subunit E
  KO
K05569  multicomponent Na+:H+ antiporter subunit E
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smd02000]
    Smed_0611
Transporters [BR:smd02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Smed_0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MNHE
Motif
Other DBs
NCBI-GeneID: 5321447
NCBI-ProteinID: YP_001326302
UniProt: A6U737
Position
660550..661026
Genome map
AA seq 158 aa AA seqDB search
MKFLLTNVIFTLIWGAISASFTPANLLLGFAAGALSLWLIRRELRPVTYPLRPLRLLLLA
LLFFRELAISATKVAIRVLRPNMELKPGIFAYPLAVNSDFEITLLANLITLTPGTLSVDV
SEDRKTLYVHALDCADPAALRRDIAGGFERRIREAFER
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctgctgaccaacgtaattttcacgctgatctggggagcaatcagcgccagc
ttcacgcccgcgaacctattgctgggcttcgcagccggcgccctgtcgctctggctgatc
cgacgggagctgcgcccggtgacttatccgttgaggcccttgcggcttctgctgctcgca
ttgctgtttttcagggagttggcgatctccgcaaccaaggtcgcgatccgggttctgcgt
ccgaatatggaactgaagcccgggatttttgcctatccgctcgcggttaacagtgatttc
gagataacgctgctcgccaacctgatcacactgacgccgggaactctgtcggtggatgtc
tccgaagatcgcaagaccctctatgtacatgcgctcgattgcgccgatccggcagccttg
cggcgagacattgccggcggcttcgagcgccgaatccgggaggccttcgaacgatga

DBGET integrated database retrieval system