KEGG   Sinorhizobium medicae: Smed_0615Help
Entry
Smed_0615         CDS       T00555                                 

Definition
(RefSeq) Fe-S metabolism associated SufE
  KO
K02426  cysteine desulfuration protein SufE
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Smed_0615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SufE
Motif
Other DBs
NCBI-GeneID: 5321451
NCBI-ProteinID: YP_001326306
UniProt: A6U741
Position
complement(662694..663116)
Genome map
AA seq 140 aa AA seqDB search
MTSIDQIIDDFAFLDEWEDRYRYVIELGKSLPEMPESSRTSENKVQGCASQVWLVTHTAG
AAEDPLLTFEGESDAHIVRGLVAIVLAIFSGKPASEITRIDALEIFGKIGLIEHLSSQRA
NGLRSMIRRIKSEAEGRLHA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaattgaccagatcatcgacgactttgcattcctcgacgaatgggaggaccgt
tatcgctatgtgatcgagcttggcaaaagcctgcccgagatgccggaatcttcgaggacg
agcgagaacaaggttcaaggttgcgcaagccaggtctggctcgtgacccatacggcgggc
gctgcggaagacccgcttctcaccttcgagggagaatcggacgcacatatcgtgcgcggc
cttgtggcgattgtccttgccatcttctccggcaagcccgcctcggagattaccaggatc
gatgctctggagatcttcggcaaaatcggcctcatcgaacatctatcctcgcaacgcgcg
aacggcctcagatcgatgatccggcgcataaagagcgaggccgaaggtcgcctgcacgct
tga

DBGET integrated database retrieval system