KEGG   Sinorhizobium medicae: Smed_0616Help
Entry
Smed_0616         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5330
Motif
Other DBs
NCBI-GeneID: 5321452
NCBI-ProteinID: YP_001326307
UniProt: A6U742
Position
complement(663259..663678)
Genome map
AA seq 139 aa AA seqDB search
MWFLVKATFWFSLVLVLLPFLDPSSSEKLEHGPKMEISGTFSAANEAFQYISAICVEKPD
VCEKGTETFVALGHRAREGARIAYEFLNSQFAEGDAGAPDVKVMTGTVTPAEDHPSEEAA
EKTEPAFKRMPVPERRLAH
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtggtttctcgtaaaggcgacgttctggttctcgctcgttctggtgctgctgcccttt
ctcgatccctcaagcagcgagaagctcgagcacggcccgaaaatggagatcagcggcacg
ttttcggccgcgaacgaggctttccagtacataagcgcgatctgcgtagaaaagcccgat
gtctgcgagaagggtacggagactttcgtcgccctcggtcatcgtgcccgcgagggcgct
cggatcgcctatgagttcctcaacagccagttcgcggaaggcgacgccggcgctcccgac
gtcaaggtgatgacgggcaccgtcacaccggcggaagatcacccttccgaggaggcggcc
gagaagacagagcccgccttcaagcgcatgccagttcccgaacgacgcctcgctcactga

DBGET integrated database retrieval system