KEGG   Sinorhizobium medicae: Smed_0632Help
Entry
Smed_0632         CDS       T00555                                 

Definition
(RefSeq) putative outer-membranne lipoprotein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 17kDa_Anti_2 DUF5061 LPAM_2
Motif
Other DBs
NCBI-GeneID: 5321468
NCBI-ProteinID: YP_001326323
UniProt: A6U758
Position
677790..678236
Genome map
AA seq 148 aa AA seqDB search
MTRAFASSGRIAVVASSVALSGCGTTSSGQGGAVAGLGAASTRVVSSATYIEALQGGVVS
RLAGVDLGKSDRQRALEAEYRALEAAPGGQPVAWQGRGVSGSVVAAAPYQVGSQNCRQYS
HTVTVKGQQSTARGAACRNSDGSWTPLT
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgggccttcgcgtcgagcggcaggatcgcagtcgtggcatcgagcgtagccctg
agcggctgtggcacgacctcgtccggccaaggcggggcggttgcgggccttggcgcagcc
tctacccgcgttgtgtcatccgcgacgtatatcgaggccctgcagggcggtgtcgtttcg
cgcctcgccggcgtcgacctcggcaagtccgatcggcagcgggcgcttgaggctgagtat
cgtgcgctcgaggcggcgccgggcggacagcccgtcgcctggcaggggcgcggcgtcagc
ggctcagtcgtcgcggccgcaccctatcaggtcgggtcgcaaaattgccgccaatacagc
catacggtcacggtcaagggtcagcaaagcacggcacggggtgctgcctgccgcaacagt
gatggaagctggacaccgctcacctga

DBGET integrated database retrieval system