KEGG   Sinorhizobium medicae: Smed_0634Help
Entry
Smed_0634         CDS       T00555                                 

Definition
(RefSeq) cytochrome c-type biogenesis protein CcmE
  KO
K02197  cytochrome c-type biogenesis protein CcmE
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    Smed_0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CcmE Syndecan
Motif
Other DBs
NCBI-GeneID: 5321470
NCBI-ProteinID: YP_001326325
UniProt: A6U760
Position
679510..679962
Genome map
AA seq 150 aa AA seqDB search
MTRKQKRLAIIGGGVGFLTAAVLLVMFAFSQAVAYFYVPGDLTKADVAPGTRIRLGGLVE
AGSVKRGEGRTITFKVTDTLATVPVTYTGILPDLFREGQGVVAEGAFVGGSPVFVADTVL
AKHDETYMPKDVADRLKAQGVTLGGEENIR
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcaagcagaaacgattggcaatcatcggaggtggcgtcggatttctgacggcg
gcggtcctgctcgtcatgttcgcttttagccaggcggtcgcctatttctacgtcccggga
gatcttacgaaagccgacgtcgcgccggggacgcgtatccgcctcggcgggcttgtcgag
gcaggctccgtcaaacgcggcgagggcaggaccattaccttcaaggtgacggatacgctt
gcgaccgttccggtgacctatacgggtatcttgcccgacctcttccgcgaggggcagggc
gtcgtggccgagggtgccttcgtcggcggcagcccggttttcgttgcggacaccgtgctc
gccaagcatgatgagacctacatgccgaaggatgtcgcagatcgcctcaaggcccagggg
gtcacgcttggcggggaggaaaacatccgatga

DBGET integrated database retrieval system